KEGG   Micropruina glycogenica: MPLG2_3208Help
Entry
MPLG2_3208        CDS       T05338                                 

Definition
(GenBank) DNA ligase D
Organism
mgg  Micropruina glycogenica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: SPD88238
UniProt: A0A2N9JL03
LinkDB All DBs
Position
1:complement(3141102..3142025)
Genome map
AA seq 307 aa AA seqDB search
MASPAVEIPVGDRVVRVTNPDRVYFPETGWTKRDLVDYYLNVGDGIVRALRNRPCMLHRF
PDGLAGPKVHQKRLPGGAPDWVQTVELWFPRFGRTADELCVTELAQVIWAVQMSTVEFHP
WNSRRGHVEQPDEWRIDLDPMPEADFGTVRRVAQVAHEVLAELAITGYPKTSGGKGFHIY
VRIEPEWGFHEVRRAALAFARELERRIDDATTVWWRKDRDPAKIFVDFNQNARDHTIASA
YSVRGTPTGTVSTPVEWDELDDLDPRDFTLASVPARFAALGDLHAGIDDQAFRLDTLLEW
ADRDGLD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtcctgcggtcgagattccggtgggcgaccgggtggtgcgggtgaccaacccc
gaccgggtctactttcccgaaaccggctggaccaagcgcgatctggtcgactactacctc
aacgtcggcgacggcatcgtgcgcgccctgcgcaaccggccctgcatgctgcaccgcttt
cccgacgggctcgccggccccaaggtgcaccagaagcggctgcccggcggcgctcccgac
tgggtgcagaccgtcgagttgtggttcccgcgcttcggccgaaccgccgacgaactctgc
gtcaccgaactcgcccaggtgatctgggccgtgcagatgtcgacggtcgagtttcacccc
tggaacagccgccgcggccacgtcgagcagccggacgaatggcgcatcgacctcgacccg
atgcccgaggccgacttcggcaccgtccgtcgggtggcccaggtggcccacgaagtgctg
gccgagctggccatcaccggctacccaaaaacctcaggtggcaaggggtttcacatctac
gtgcggatcgagcccgagtggggttttcacgaggttcgccgcgccgcactcgccttcgcc
agagaactcgaacgacgcatcgacgacgccaccaccgtgtggtggcgcaaagaccgcgat
ccggcgaagatcttcgtcgacttcaaccagaacgcccgcgaccacaccatcgcatcggcc
tattcggtacgcggcacccccaccggcaccgtgtcgacccccgtcgaatgggacgaactc
gacgacctcgacccccgcgacttcacccttgcgtcggtgccggcccggttcgccgccttg
ggcgacctgcacgcgggcatcgacgaccaggccttccggctcgacaccctgctggagtgg
gccgatcgagacgggctcgactag

DBGET integrated database retrieval system