KEGG   Mycobacterium goodii: AFA91_05500Help
Entry
AFA91_05500       CDS       T04008                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
mgo  Mycobacterium goodii
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mgo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFA91_05500
Enzymes [BR:mgo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AFA91_05500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1133435..1134898
Genome map
AA seq 487 aa AA seqDB search
MSPVTINHLVAGEWVAGAGDALASVNPARPADVVAEGHNATTSQVDAAVTAAAEALRPWA
ATPTHQRGAVLLAAAQIVDRNAETWGLELATEEGKTRAEGIGEVRRAAQILRYYGNEGDR
QAGEIFSSPRAGEQILVTRKPLGVVAVITPFNFPIAIPAWKIAPALVYGNTVVWKPASTV
PVLAIRLAQALTEAGLPAGVLNLVIGDAETGTAIVDHPRIDGLTFTGSTTVGRRLAAVAA
SCGIPMQAEMGGKNAAVVLDDADLDVAVEQVLLGAFRSTGQKCTATSRLIVTDGIAERFT
EAVVERARALRVGDPTDDATEMGPVITGAARSSITAGIDTAIAQGATVLAGGQPYTEGPL
ADGYFVAPTVLELDGSPAKVWSEELFGPVLAIRRAADADAAFELANDSEFGLSAAVFTQD
LTRVLQAMEQIDVGVLHVNSESAGADPHVPFGGDKKSGLGPKEQGAAARDFFTHTTTVYL
RGGRPGA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggtgaccatcaaccacctcgtcgcaggcgaatgggtggccggtgccggtgac
gcgctcgccagcgtcaacccggccaggcccgccgacgtggtggccgaagggcacaacgcg
accacctcgcaggtcgacgccgcggtcaccgcggccgccgaggcgttgcgcccgtgggcg
gcgacgccgacacaccagcgcggcgcggtgctgctggccgcggcgcagatcgtcgaccgc
aacgccgaaacctggggtctggaactggccaccgaggagggcaagaccagggccgagggc
atcggcgaggtccgccgcgccgcacagatcctgcggtactacggcaacgagggtgaccgg
caggccggggagatcttctcctcgccccgcgcaggcgaacagatcctggtgacgcgcaag
ccactcggcgtggtcgccgtcatcacgccgttcaactttcccatcgcgatcccggcgtgg
aagatcgcgcccgcgctggtgtacggcaacaccgtggtgtggaagcccgcgagcaccgtt
ccggtgctggcgatccgcctcgcgcaggcgctcaccgaggcgggcctgcccgcgggcgtg
ctcaacctggtgatcggcgacgccgagaccggcaccgcgatcgtcgaccatccccgcatc
gacggcctgaccttcaccgggtccaccacggtgggccgtcgcctcgcggccgtggccgcc
tcatgcggcatcccgatgcaggccgagatgggcggcaagaacgccgccgtggtgctcgac
gacgccgacctggacgtggccgtcgagcaggtgctgctcggcgcgttccggtcgaccggc
cagaagtgcaccgccacctcacgtttgatcgtcaccgacggaatcgccgaacggttcacc
gaggcggtggtggagcgggcccgtgcgctgcgcgtcggcgaccccaccgacgacgcgacc
gagatgggtccggtgatcaccggcgccgcccgcagctccatcacggcgggcatcgacacg
gccatcgcgcagggcgccacggtgctggccggcgggcagccctacaccgaggggccgctc
gccgacggatacttcgtggccccgaccgtcctggagctcgacggctcaccggccaaggtg
tggagcgaggaactgttcggcccggtgctggcgatccgccgcgccgccgacgccgacgcg
gcgttcgaactcgccaacgacagcgagttcggcttgtccgcagcggttttcacccaggac
ctgacgcgggtgttgcaggccatggagcagatcgacgtcggtgtgctgcacgtgaactcc
gaatcggcgggggcggatccgcatgtgccgttcggcggggacaagaagagcggcctcggc
cccaaggagcagggtgccgccgcgcgcgacttcttcacccacaccaccaccgtgtacctg
cggggcgggcggccgggcgcatga

DBGET integrated database retrieval system