KEGG   Mycobacterium goodii: AFA91_27115Help
Entry
AFA91_27115       CDS       T04008                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mgo  Mycobacterium goodii
Pathway
mgo00250  Alanine, aspartate and glutamate metabolism
mgo00410  beta-Alanine metabolism
mgo00640  Propanoate metabolism
mgo00650  Butanoate metabolism
mgo01100  Metabolic pathways
mgo01120  Microbial metabolism in diverse environments
Module
mgo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mgo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AFA91_27115
   00650 Butanoate metabolism
    AFA91_27115
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFA91_27115
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFA91_27115
Enzymes [BR:mgo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AFA91_27115
Amino acid related enzymes [BR:mgo01007]
 Aminotransferase (transaminase)
  Class III
   AFA91_27115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKS34955
UniProt: A0A0K0XC25
LinkDB All DBs
Position
5809105..5810358
Genome map
AA seq 417 aa AA seqDB search
MAELSQVLKQATGVIAARGEGVLLYDEQDRRYLDFTAGIGVTSTGHCHPRVVEAAQHQVA
TLIHGQYTTVMHRPLHTLVERLGEVLPAGLDRMFFANSGSEAIEAALRLSRQATGRPNII
VFHGGFHGRTVAAASMTTSGTKFRSGYSPLMAGVHIAPFPDPTHFGWPVEQATDFALSQL
DYVLQTVSAPADTAAFLVEPVLGEGGYVPGNERFLAGLRERADAHGILLVIDEVQTGFGR
TGKFWGGDHFDAKPDILVTAKGLASGFPLSGIAASSALMAKAWPGSQGGTYGANAVACAA
ALATLDVIRDENLVANAAERGAQLKQALQTVADKHEQITDVRGLGLMIGNEFRDGDGKPD
GATAAAVQQEAARRGLLLLTCGAWGQVVRFIPALVVSADQVEEAAGIWADAVTAVVS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagctttcgcaggtcctcaaacaggcaacaggtgtgatcgccgcacgcggcgag
ggtgtcctgctctacgacgaacaggaccgcagatacctcgacttcaccgcgggcatcggc
gtgaccagcaccggccactgccacccccgggtcgtcgaggccgcacagcaccaggtggcg
acgctgatccacgggcagtacaccaccgtcatgcaccggccgctgcacacgctggtggag
cggctcggtgaggtgttgccggccggactggaccggatgttcttcgccaactccggcagc
gaggccatcgaggccgcactgcggctcagcaggcaggcgaccggccggcccaacatcatc
gtcttccacggcggcttccacggccggacggtggccgcggcgtcgatgaccacctccggt
accaaattccggtccgggtacagccccctgatggccggcgtgcacatcgcgccgttcccc
gatcccacccatttcggctggcccgtcgaacaggccaccgatttcgcgctctcccaactc
gattacgtgctgcagacggtgagcgcaccggccgacaccgccgcgttcctcgtcgaaccg
gtgctcggcgagggcggctatgtgcccgggaacgagcgctttctggccggactgcgtgag
cgcgccgacgcgcacggcatcctgctggtgatcgacgaagtgcagaccggcttcgggcgt
accggaaagttctggggcggcgatcatttcgatgccaagccggacatcctggtgacggcc
aagggcctggcgtcgggcttcccgctgtccgggatcgccgcgtcgtcggcattgatggcc
aaggcgtggccgggttcgcagggcggcacctacggggcgaacgcggtggcgtgcgcggcc
gcgctcgccacgctcgacgtgatccgcgacgagaacctcgtcgccaacgccgccgaacgc
ggcgcacaactcaagcaggccctgcagacggtggccgacaagcacgaacagatcaccgat
gtccgcgggctcgggctgatgatcggcaacgaattccgcgacggcgacggcaaacccgac
ggcgcgaccgccgccgcggtgcagcaggaggcggccaggcggggattgctgctgctgacg
tgcggggcgtgggggcaggtggtgcgcttcatcccggcgctcgtcgtctccgccgatcag
gtggaggaggccgcgggtatctgggccgacgccgtgaccgccgtcgtgtcctga

DBGET integrated database retrieval system