KEGG   Mycobacterium goodii: AFA91_31055Help
Entry
AFA91_31055       CDS       T04008                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mgo  Mycobacterium goodii
Pathway
mgo00250  Alanine, aspartate and glutamate metabolism
mgo00410  beta-Alanine metabolism
mgo00430  Taurine and hypotaurine metabolism
mgo00650  Butanoate metabolism
mgo01100  Metabolic pathways
mgo01110  Biosynthesis of secondary metabolites
mgo01120  Microbial metabolism in diverse environments
mgo02024  Quorum sensing
Module
mgo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mgo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AFA91_31055
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFA91_31055
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFA91_31055
   00430 Taurine and hypotaurine metabolism
    AFA91_31055
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AFA91_31055
Enzymes [BR:mgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AFA91_31055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AKS36786
UniProt: A0A0K0XHC3
LinkDB All DBs
Position
complement(6643631..6645022)
Genome map
AA seq 463 aa AA seqDB search
MSHKHSRGPHVAPAYTGRLAMAPVPSLRLPDEAMDPAAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEDLRDDDPASAVG
VSTIGSSEAVMLAGLAMKWRWRQKLERNGEQWKGRTPNLVMGANVQVVWEKFCRYFDVEP
RYLPMAEGRYVITTEQVLDAVDEDTIGVVAILGTTYTGELEPVAEICEALDELAQGGGVD
VPVHVDAASGGFVVPFIHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRNSEHLPE
ELVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTQVMQCLSQTARWLGDEL
RDSEHFELISDGSAIPVVAFRLKGEPGYTEFDVSQALRAHGWQVPAYTMPEGAEDVVVLR
VVVREGFSADLARALKDDIITVLGQLDELKPRGQFDGVQPFAH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaagcacagtcgcggtccgcacgtcgcgccggcgtacaccggacggttggcg
atggcgccggtgccgtcgctgcgcctgcccgacgaggcgatggacccggctgcggcctac
cggttcatccacgacgagttgatgctcgacggcagctcgcggctgaacctcgcgacgttc
gtcacgacgtggatggaccccgaggccgagaagctcatggccgagacgttcgacaagaac
atgatcgacaaggacgagtacccggccaccgcggccatcgaggcccgctgcgtgtcgatg
gtcgccgacctgttccacgccgaggacctgcgcgacgacgacccggccagcgcggtcggg
gtgtcgacgatcgggtccagcgaggccgtgatgctcgcaggcctggcgatgaagtggcgg
tggcgccagaaactcgagcgcaacggcgagcagtggaagggccgcaccccgaacctggtg
atgggcgccaacgtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccg
cgctacctgccgatggccgagggccgctacgtcatcaccaccgaacaggtcctcgacgcg
gtcgacgaggacaccatcggcgtcgtcgcgatcctcggcaccacctacaccggtgaactg
gaacccgtcgccgagatctgcgaggccctcgacgaactcgctcagggtggcggggtggac
gtgcccgtccacgtcgacgcggccagcggcggtttcgtggtcccgttcatccatcccgac
ctggtgtgggacttccggctgccacgggtggtgtcgatcaacgtcagcggccacaaatac
ggcctgacgtacccgggcgtgggtttcgtggtgtggcgcaactccgaacacctgcccgag
gaactggtgttccgggtcaactacctcggcggcgacatgccgacgttcacgctgaacttc
tcccggccgggcaatcaggtggtggggcagtactacaacttcctgcgcctcggccgggcc
ggctacacgcaggtgatgcagtgcctgtcgcagaccgcgcggtggctcggcgacgagctg
cgcgacagtgaacacttcgagctgatctccgacggctcggcgatcccggtcgtcgcgttc
cggctcaagggcgaaccgggttacaccgagttcgacgtgtcccaggcgctgcgggcgcac
ggctggcaggtgcccgcctacaccatgcccgagggcgccgaggacgtcgtggtgctgcgc
gtggtggtccgcgagggcttctccgccgatctcgcgcgggcgctcaaggacgacatcatc
acggtgctcggccagctcgacgagctgaaaccgcgcggccagttcgacggtgtgcagccc
ttcgcgcattag

DBGET integrated database retrieval system