KEGG   Meleagris gallopavo (turkey): 100542556Help
Entry
100542556         CDS       T01523                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6-like
  KO
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100542556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
22
AA seq 721 aa AA seqDB search
MYKFKGMFSMNLLYVFLAQKITNIDWHSKLNKAAHHTSDYNSMQVILRRGQAFTITLNFQ
TTVQPEDNFTFIASTGLSPAESQQTKAIFHLSEDAASGWSATQEHCEPGRMSLIIVSPAN
AIIGRYKLKLQIASGNKTSSALLGQFVLLFNPWCPNDDVYMANENERQEYVLNDSGIIFQ
GKEKYIQQEAWNYGQFEEDILDISLSILDRSLNHRQDPSTDVSNRNDPIYVCRVISAMVN
SNDEKGVVEGKWSGNYRSGTNPLHWSGSVTILRKWYRGRYKPVRYGQCWVFAGVMCTVLR
SLGIPTRVITNFNSAHDSNINLSIDKYIDVSGNTLNLTEDSVWNFHVWNESWFTRRDLGS
FYDGWQVLDATPQEKSKGIYRCGPASTRAIKEGDVNLDYDSSFVFAAVNADCVTWIQHSN
KRKERIYSNTRKIGKFISTKAVGTNTRVDITDNYKYPEGSSKERQVYKKALKLLAVRNTG
KRKKVTKPTRRFPVARRQNMRATTRKPTVSGKLKLDASTVIGQDILLTLALQNLTAEFKT
MKVKLKASAVLYTRKPKAEILQWSRTVQLGSEEVKEISFKITYSQYKNALLDDRKILVTA
VCEDRQGASLLLEKDIVLQDPLLTIEVLGPTVVHKATNVLVTFTNPLSEVVTDCVLRAEG
SGLLKEQLNINVARMAPMETSTAEFEIIPYKSGIRQLQVDLACIRFSNIKGFVMLDVAPA
Q
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgtataagtttaaaggaatgttttccatgaacttactttacgtttttctagcccagaaa
ataacgaacattgactggcactctaagctaaacaaagctgcacaccacacatctgattac
aacagcatgcaagtgatcttgaggagaggacaggctttcactattaccctaaacttccaa
acaacagtgcaacctgaggacaacttcacatttattgcaagcacaggactatctccagca
gaatcacagcagaccaaggccatatttcacctttctgaggatgctgccagtggctggagt
gcaacccaagagcactgtgagcctggccgcatgagtctcatcatagtcagccctgccaat
gccatcattggacgatacaaactcaaactccagattgcttctggcaacaagacctcttca
gcactcctaggccagtttgtgttactcttcaatccttggtgtccaaatgacgatgtctat
atggctaatgaaaatgagcgacaggagtatgttctgaatgacagcggaatcatatttcag
ggaaaggaaaaatatattcagcaggaagcttggaattatggacagtttgaagaagatatc
cttgatatctctctgtctatactggatcgaagcctgaaccaccgccaagatccatccact
gatgtatccaacaggaacgatcccatctatgtgtgcagggttattagtgctatggttaac
agcaatgatgaaaagggagtagtggaagggaagtggagtggaaactatcgctcaggaacc
aaccccttgcactggagtggaagtgtgaccatccttcgaaagtggtacagagggagatac
aaacccgtccggtatggccagtgctgggtctttgcaggagttatgtgcacagttctgaga
tcgctgggaatacctacccgtgttattacaaactttaactctgcccatgatagtaatatc
aacctgagtattgacaaatacattgatgtttctggaaataccctgaacttgactgaagac
agcgtgtggaatttccatgtctggaacgagagctggtttactagaagagatcttggatct
ttttatgatggatggcaggttctggatgcaacaccccaggaaaaaagcaaaggcatctat
cgatgtggcccagcttccaccagagccattaaggaaggagacgtgaacctggattatgac
agctcatttgtgttcgcagcagtgaatgctgactgtgttacttggattcagcatagcaac
aaaagaaaagagagaatttactccaataccaggaagattggaaaatttattagcaccaaa
gcagtgggcaccaacacccgagtggatatcactgataattacaaatatccagaaggatcc
tccaaagaaaggcaggtgtacaaaaaggcactgaagctgctggctgtgagaaacactgga
aaaagaaaaaaagttacaaaacccacgagacgatttccagtagcacggagacaaaatatg
agagcgaccacacgaaaacccactgtctcagggaagctgaagctggatgcatctactgta
ataggccaggatatcctcctcaccttggcactgcagaatttgactgcagagttcaagacc
atgaaggttaaactgaaggcttcagctgttctctacacaagaaaaccgaaggcagagatc
ttgcagtggtctaggactgttcaacttggatctgaagaagtgaaagaaatctcattcaag
atcacctactcccagtacaaaaatgctctgctggatgacaggaagatcctagtgactgct
gtgtgtgaagacagacagggagcatcacttctactggagaaagatattgtacttcaggat
cctcttctcaccatcgaggtccttggtccaacagtggtacacaaggccactaacgtgctg
gtcacatttaccaacccgctgtctgaagtggtgacagactgtgtgctgagagcagaaggt
agcggcctgctcaaagagcaactcaacatcaatgtggcaagaatggcccccatggagacc
tcaacagctgagtttgagattattccctacaagagtggcatcaggcagcttcaggtggac
ttggcttgcatccgattttcaaacatcaagggatttgtgatgcttgatgtggctcctgcc
cagtga

DBGET integrated database retrieval system