KEGG   Meleagris gallopavo (turkey): 100546927Help
Entry
100546927         CDS       T01523                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04110  Cell cycle
mgp04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100546927 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100546927 (HDAC1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100546927 (HDAC1)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100546927 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100546927 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100546927 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100546927 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100546927
NCBI-ProteinID: XP_010721789
Ensembl: ENSMGAG00000004647
LinkDB All DBs
Position
25
AA seq 488 aa AA seqDB search
MWFEWLHLKQFMFFPAVTKSFLSPGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKME
IYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQL
SAGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLY
IDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGI
DDESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFN
LPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTN
QNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPEDAVQEDSGDEEEEDPEKRISIRNSDK
RISCDEEFSDSEDEGEGGRKNVANFKKAKRAKTEEEKEEEEKKDEKEEEKAKEEKAEPKG
VKEETKST
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttgagtggttgcatttgaagcagttcatgtttttccctgctgtaacaaaatcc
tttctgtccccaggtgatgttggaaactattattatggccagggacaccccatgaagccc
cacaggatccggatgacccacaacctactgctgaactacggcctttacaggaagatggag
atatatcgccctcacaaggcgaacgcggaggagatgaccaagtaccacagcgacgactac
atcaaattcctgagatccatccgcccagacaacatgtctgagtacagcaagcagatgcag
agatttaacgtcggggaggactgccctgtgttcgatgggctgtttgagttctgtcagctc
tctgctggaggctcagttgccagcgctgtgaagctgaacaagcagcagacagatattgct
gtgaattgggcaggaggcctccaccacgctaaaaagtcggaggcttctggcttctgttat
gtcaacgacattgtcctggctatcttggagctcttaaagtatcaccagagggtcctgtat
atcgacattgatattcaccatggagatggtgtggaggaagccttctataccacagaccgt
gtgatgaccgtgtcctttcataagtatggagagtacttcccaggaacaggggacctgcgg
gacattggtgcaggcaaaggcaagtactatgctgtcaactatcccctccgggatgggatt
gatgatgagtcctatgaggcaatattcaagccggtgatatctaaagtgatggagacattc
cagcctagtgcagttgtcctgcagtgtgggtcagattctctgtccggagacaggctgggt
tgttttaatctgaccatcaaaggtcatgccaagtgtgtggagtttgtcaaaagttttaat
ttgcccatgctgatgctgggaggaggtggctacacgatccgcaacgtggccagatgctgg
acctacgagactgctgtggctttggacactgagatcccaaatgaactcccatataatgac
tattttgagtacttcggaccagactttaagctgcacatcagtccctcaaacatgactaac
cagaataccaacgagtatctcgagaagatcaagcagcgtctctttgagaatctgcgcatg
ctgcctcatgcccctggcgtccagatgcagccaattcctgaggatgctgttcaggaagac
agtggagatgaagaggaagaagatcctgagaagcgcatttcaatccgcaattctgataag
agaatatcctgcgatgaggaattctctgactctgaagatgaaggggaaggagggcgcaaa
aatgttgctaactttaagaaggccaagcgtgcgaaaacagaagaggaaaaagaggaggag
gagaagaaggacgagaaagaagaagaaaaagcaaaagaggagaaagccgaacccaagggg
gtgaaggaagagacaaaatccacctaa

DBGET integrated database retrieval system