KEGG   Meleagris gallopavo (turkey): 100550092Help
Entry
100550092         CDS       T01523                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00590  Arachidonic acid metabolism
mgp01100  Metabolic pathways
mgp04370  VEGF signaling pathway
mgp04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100550092 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100550092 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100550092 (PTGS2)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100550092 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 100550092
NCBI-ProteinID: XP_010713838
Ensembl: ENSMGAG00000001287
LinkDB All DBs
Position
10
AA seq 571 aa AA seqDB search
MTTGFDRYECDCTRTGYYGENCTTPEFFTWLKLTLKPTPNTVHYILTHFKGVWNIINNIS
FLRDTIMRYVLTSRSHLIDSPPTYNSDYNYKSWEAYSNLSYYTRSLPPVGHDCPTPMGVK
GKKELPDSKLIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQFFKTDHKKGPGFTKAFGH
GVDLNHIYGETLERQLKLRLHKDGKLKYQMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDEQLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFKSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEIG
APFSLKGLMGNTICSPEYWKPSTFGGKVGFEIINTASLQKLICNNVKGCPFTAFHVLNPE
PTEATINVSTSNTAMEDINPTLLLKERSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggctttgaccggtatgaatgtgactgcacgaggacaggctattatggggaa
aactgtacgacaccggaattcttcacgtggctgaaactaacattgaaacctacaccaaat
actgtccactacattctcacccacttcaaaggagtctggaacatcatcaacaacatttcc
ttcttacgagatactattatgagatacgtgttgacatcaagatcacacttgattgacagc
ccaccaacatacaatagtgactataattacaaatcctgggaagcttattctaatctttcc
tattacacaagaagccttccaccagtaggacatgactgtccaacaccgatgggtgttaaa
ggtaagaaagagctcccagattcaaagctgattgtggagaaattcttgctgcggagaaaa
tttattcctgacccacaaggcacaaatgtgatgttcacattctttgcccagcacttcact
catcagttctttaagacagaccataagaaaggacctggcttcactaaagcttttggccat
ggggttgacttgaaccacatttatggagagactctggagaggcaacttaaattgagactt
cacaaggatggaaaactaaagtaccagatgattgatggagaaatgtatccaccaacagta
aaggacactcaagcagagatgatctaccctcctcacgttcctgagcacctgcagttttct
gttgggcaggaggtgtttggcttggtcccaggcctaatgatgtatgcaacgatatggctg
agagaacacaatagagtctgtgacatcttgaaacaggagcatccagagtgggatgatgag
cagctatttcagactacaagactcatattgataggagaaacgatcaagatagttattgaa
gattatgtgcaacacttgagtggctaccacttcaaactgaagtttgatcctgagcttctg
ttcaaccagcgttttcaataccagaaccgaattgcagctgaattcaatactttgtaccac
tggcacccacttctgcctgacacttttcagatacatgaccaggagtacactttccagcag
ttcctctacaacaactccataatgctggaacatggcctttcccatatggtgaaatctttc
tccaagcaaagtgctggcagggttgctggtggcaaaaatgttccagctgcagtacagaaa
gtagcaaaggcttcaattgaccaaagcagacaaatgagataccagtccttgaatgagtac
aggaaacgcttcatgttgaaaccattcaaatcatttgaagaacttacaggagaaaaagaa
atggctgctgaactagaagagctttacggagacatagatgctatggaactgtatccaggc
cttcttgtagaaaagccaagaccaggtgccatctttggtgaaacaatggtagaaattggc
gcaccgttctctctgaaaggactgatgggaaatacaatatgctcccctgagtattggaag
ccaagcacctttggtggaaaagtggggtttgaaataatcaatactgcctccctacagaag
ctcatctgcaacaatgtgaaaggctgtcctttcactgctttccatgtcttaaatcctgaa
cccacagaggcaactattaatgttagtacctcaaacacagcaatggaagatatcaacccc
acactactactgaaagagcgatctgctgagttgtaa

DBGET integrated database retrieval system