KEGG   Magnaporthe oryzae: MGG_06043Help
Entry
MGG_06043         CDS       T01027                                 

Definition
(RefSeq) histone deacetylase HOS3
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MGG_06043
Chromosome and associated proteins [BR:mgr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     MGG_06043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 2683932
NCBI-ProteinID: XP_003711894
UniProt: G4N4X5
LinkDB All DBs
Position
3
AA seq 1141 aa AA seqDB search
MAYRSPSRGPNRQPTDDNDELAQSLRHLSLSARSPQNGTQRSPSSMSISRSPSSLSVRGA
APRSPLAEGGRPASRAGTPGLLRKASMNSLHSVNGVAPPRRASSVNISSPSASRSPRHST
SPPERKPAQTAASVARDYFKLELAVRHGEQPDPTSETVVIMHDSCYGHRFSRPRTSRAAL
STIVERPERIKASALGVAAAYVRLGERHSDGIHPIDPSLDPAAIPSIPFRIQKTTRRLPL
MSQAVTNVHGTKWMEELKMMCDSAETKLAMNGKELQRPDMPRGPEQNGPPPKFHEGDLYL
CSESLDALEGSLGGVCEAVDAVFTPENPAKRAFVAIRPPGHHCSASFPSGFCWVNNVHVG
IMHGILSHGLTHAAIIDFDLHHGDGSQAIAWQHNTRGIGLSTNAAWWKKPSIGYFSLHDI
NSYPCEMGDEEKVKNASLCIENAHGQNIWNVHLLPWKTEEDFWRLYESKYKVLLDKTREF
LRAQTERFRNAGQSNVAKGAIFLSAGFDASEWEGAGMQRHKVNVPTEFYARLTRDVVKIA
AEEETSVEGRVISVLEGGYSDRALCSGILSHVSGLAGDDPVDFAPLKGLRGEVNKRLSGA
SLTHARRESFSLKNTFPLHPYEAEWWHASELERLETVMAAPMEAPEPRKPRNCTPPTYSS
PTQSSQAKVVYNPSKIRRSLPSTTDGRSSPMPVPRAPTPPPPDVPWTVAAHELSKLLIPS
DRQTGSCKPEDLNAEATRQRRDRQSIALAAAASSLPSPTIVESIEVDEPPRSSTRMSLRE
RKAPKSYSESNKDDFAKGDRRKTVAGPSVIATDKAAARGFPAAAGRSKQTPRRLSAASTV
VSEVPDGFLPPPMNGAVVRPSTSLSIRPESSMSVRSTMTTGGSLPIKKTRVAPMKKDVVP
KAPRGAKKAAPPSIPQIKTEKEDEGPSPVASRVPASTSSMLTQPKESNDEMDSLTTNMKK
VKITLLTKAQKEAREQKAAMPTNGNQVVTPTEERSPIVLVPGSAPERMQSGRSIASKPPL
NVSSVDSSSGYPAAPSTPDMFIPFQPEGPVPEPHPQSNQQQQLQWLPPNVGTPSPVKRQD
LPVFSATGTIPFASATGKPSSPLRGGTDAPDKTSSGVSTPIPKSRVQQVRSMWEVPETPQ
K
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccgttcgccctcgagagggccaaatcgccagcctacagacgataacgatgag
ttggcgcaatcgctccgacacctctctctttcggcgagatctccacaaaatggcactcag
cgttctccaagctccatgagcatctcgaggtctccaagctctttaagcgtccgaggcgcc
gccccgcgaagtcccctggctgagggcggccgtccagcgtctcgcgctggcaccccaggc
ctactgcgcaaggcttcaatgaactccctacactctgtgaacggtgtcgcgccgccacgc
cgggcaagctccgtcaatatctcatccccttcggcttcacggtcgcctcgccacagcacc
tcgccgccggagcggaagccagctcagacggctgcctctgttgcccgtgattacttcaag
cttgagctggcagtccggcatggtgagcaaccagaccccacctccgagactgttgtaatt
atgcacgacagctgctacggacatcgattttcccgccctcgcacctcccgggctgccttg
agcacgatagtcgagcgaccggaaaggatcaaggcgagcgcacttggtgtagctgctgcc
tatgtacgtctgggagagcgacattctgatggaatacatcccattgatccaagtcttgat
cctgcggcaataccctcgataccgttccggatacaaaagaccacacgtcggttgccgctg
atgtcgcaggcggttacgaacgtacacggcaccaagtggatggaggagctgaaaatgatg
tgtgactctgcggaaacaaagctggcgatgaacggaaaggaactgcagcggccggacatg
cccaggggcccggaacaaaacgggccgccgccaaagttccacgaaggagacttgtatctc
tgctccgagtcgctggatgctctagagggttccctgggaggtgtatgcgaggccgtggat
gctgtcttcactccagaaaaccctgcaaagcgtgcttttgtcgcaattcggccaccgggt
catcactgctctgcttcgttcccctcaggattctgctgggtcaataatgtgcatgttgga
atcatgcacggaattcttagccatggactgacccatgcggccattattgactttgacttg
caccatggtgacggctcgcaggccattgcttggcagcacaatacacgcggtattggactg
tcgacgaatgccgcctggtggaagaagccgtcgattggatattttagtctgcacgacatc
aactcttatccatgcgaaatgggcgacgaagagaaggtcaaaaacgcaagcttgtgcatt
gaaaatgcgcatggccagaatatttggaacgtccacctgctaccatggaagacagaagag
gacttctggcggctgtatgagtccaaatacaaggtactactggacaagacgagagagttt
ctcagggctcaaacagaacgcttccgaaatgctggccagagcaatgttgccaagggtgcc
atctttctctctgctggatttgatgccagtgagtgggagggtgcaggtatgcaacgacat
aaagtcaacgttccaacagaattctatgctcgtctcacgcgggatgtcgtcaagatcgcg
gcggaagaggagaccagcgtcgagggcagagtaattagcgtcctcgagggtggctatagc
gatcgtgcactttgttcgggtattttgagtcatgtaagcggcctggcgggtgacgatccc
gtagacttcgctcctttgaagggccttcgcggagaagtcaataaaaggctaagtggagca
agcctcactcatgctcggagagaatctttcagcctcaagaacacattccccctccacccg
tacgaagcagagtggtggcatgcttcagaactcgagcggcttgagacggtcatggctgcc
ccgatggaggctcctgagcccaggaagccccgtaactgtacgcccccgacatattcatct
cccacgcagtcatctcaagccaaggtggtgtacaatcccagcaaaatccgtcggagtttg
ccatccacgaccgacgggaggagctcacccatgcccgtaccacgagcaccaacaccacca
ccacctgatgttccatggaccgtcgcagcccatgagcttagcaaacttttgatccccagc
gatcgtcaaacaggtagctgcaagccagaagacctcaacgcagaggcgacacggcaaagg
cgggatcgccagtctatagcactggcggctgcagcgtcatcgttgccatctcctacaata
gttgagtccattgaggttgacgagccccctcgctcttccacgagaatgtcactgcgcgaa
cggaaggccccgaagtcatattcagagtcgaataaggacgactttgccaagggcgatcgc
agaaagactgtggcggggccatctgttattgcaacagacaaggctgcagcaaggggtttt
cctgcggccgccgggaggtctaagcaaaccccgagacgtcttagtgctgcatcgacagtt
gtgtccgaagttcctgatggattcctgccccctccaatgaatggtgcggttgtaagaccc
agcacatcattgagtatcaggccagagtcgtcaatgagcgtccgcagcacgatgaccact
ggtggatccctacctatcaaaaagacgcgtgtagctcccatgaagaaggatgtagtcccg
aaggccccccgcggtgcaaagaaagctgcgcctccgagcatccctcaaatcaagacggag
aaggaagatgaaggcccgagtcccgttgcttcgcgagtaccggcttctacatcatctatg
ctaactcagccaaaagaaagcaatgatgagatggatagtctcactaccaacatgaaaaaa
gtcaagatcactctgctcacaaaggcgcaaaaggaagctcgcgagcagaaggcagctatg
cccacaaacggcaatcaagtagtcacacctacagaggagcggtcaccgattgttctcgta
ccgggaagcgcgccggagcggatgcaatcaggacgaagcatcgcttccaagcctcccctg
aacgttagttcggtcgactcatcttcgggctatccagccgctccctcgacgcccgacatg
ttcataccattccagccggaaggtccggtcccggagccacatcctcaaagtaaccagcag
cagcagctccaatggctcccgcccaatgttggaacgccgtctcccgtgaagcgacaagat
ttaccggtattttcagctactggaacgatcccttttgcaagtgcgacgggtaaaccatcg
tctcctttgcgtggcggcactgatgctcctgacaagaccagcagcggagtttcaacacct
attcctaagtcgcgtgttcaacaagtcaggtcaatgtgggaagttccggagacgccacag
aagtag

DBGET integrated database retrieval system