KEGG   Magnaporthe oryzae: MGG_09640Help
Entry
MGG_09640         CDS       T01027                                 

Definition
(RefSeq) alpha-amylase 1
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MGG_09640
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MGG_09640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 532 aa AA seqDB search
MRFSHLVWVAASALLNTADAATKEQWKGRSVYQLMTDRYARTDGSLTATCEPQKFCGGTW
AGLLKKLDYIQSMGFTAIQISPIVKNIDDDTAVGEAYHGYWSLDNYALNDKFGTKDDLKA
LIDELHKRDMYIMVDVVVNNMAQKFDNIIPPKVDYSKFNPFNDKKYFHPYCNVTQWDSPD
HTNIQECWLYPYGVALADLATETAPVADEFNKWIKQLVSNYSIDGLRIDAAKHVNPSFLG
PFVQSSGVFTWGEILTGEISDFCPYQNQGQLPGMPNYLEYYKINTVFNGGSMKSLAAIHK
DAQSGCNDTLALGSFVENHDMPRFANKNKDMALAKNAMAYILMTDGIPTVYQGQEQHFDG
GDTPFNREPLWTSKYDQKSELYTLTATLNKARNAANKASNGTYATTYAQELMVDDNHYCM
RKGPTGSQLVFCISNKSSKGDSYNMQVPKGFGSGDDIVEILTCKTAKADGSGVVTMPMSK
GEPRVYALQSSLKDSGLCKDGTSSQSLNGAGGVRAGGLMGLVAVAVSLMFVM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttttcccacttggtttgggtcgccgcctcggccctcttgaacacggctgatgcc
gccaccaaagaacagtggaagggtagatcggtctaccagttgatgaccgaccgctacgcc
cgcaccgacggctccctgacggcgacatgtgagccgcagaagttttgcggaggaacctgg
gccggtctcctcaagaagctcgactacatccagagcatgggcttcacggcgatccagatc
agccccatcgtcaagaacatcgacgacgacaccgcggtcggtgaggcctaccacggctac
tggtccctcgacaactatgccctgaacgacaagtttggaaccaaggatgacctcaaggcc
ctgatcgacgagctgcacaagcgtgacatgtacatcatggtggacgtcgtcgtcaacaac
atggcccaaaagttcgataacatcatcccgcccaaggtcgactactccaagttcaacccc
ttcaacgacaagaagtactttcacccgtactgcaacgtgacccagtgggacagccccgac
cacaccaacatccaggagtgctggctgtacccctacggcgtcgccctcgccgacctggcc
accgagaccgcgcccgtggccgacgagttcaacaagtggatcaagcagcttgtgtccaac
tactccatcgacggtctccgtatcgacgccgccaagcacgtgaacccgtccttcctggga
ccctttgtgcagtcttcgggcgtcttcacctggggagagatcctgaccggtgagattagc
gatttctgcccctaccagaaccagggccagcttccgggaatgcccaactacctcgagtac
tacaagatcaacactgtcttcaacggcggttccatgaagagcctggccgccatccacaag
gatgctcagtccggctgcaacgacaccctcgccctgggcagctttgtcgagaaccacgac
atgccgcggtttgctaacaagaacaaggacatggctttggccaagaacgccatggcttac
atcctgatgactgacggtattcctactgtttaccaaggtcaggagcagcactttgacggc
ggcgacacccccttcaaccgcgagcctctctggacctccaagtacgaccaaaagtcggag
ctgtacacgctgacggcgacgctcaacaaggcccgcaacgccgccaacaaggcgtccaac
ggcacctacgccacgacgtacgcgcaggagctcatggtggacgacaaccactactgcatg
cgcaagggcccgaccggcagccagctcgtgttttgcatcagcaacaagagcagcaagggc
gacagctacaacatgcaggtgcccaagggcttcgggtccggcgacgacatcgtcgagatc
ctgacctgcaagaccgccaaggccgacggctccggcgtcgtcaccatgcccatgtccaag
ggcgagcccagggtctacgcgctgcagtcgagcctcaaggacagcggtctctgcaaggac
ggtacctcgtcccagtcgctcaacggtgccggtggcgtccgcgccggtggtctgatgggt
ctggttgccgtggctgtgtcgttgatgtttgtcatgtaa

DBGET integrated database retrieval system