KEGG   Magnetospirillum gryphiswaldense: MGMSRv2__0148Help
Entry
MGMSRv2__0148     CDS       T02960                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mgy  Magnetospirillum gryphiswaldense
Pathway
mgy00620  Pyruvate metabolism
mgy00680  Methane metabolism
mgy00710  Carbon fixation in photosynthetic organisms
mgy01100  Metabolic pathways
mgy01120  Microbial metabolism in diverse environments
mgy01200  Carbon metabolism
Module
mgy_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mgy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGMSRv2__0148 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MGMSRv2__0148 (ppc)
   00680 Methane metabolism
    MGMSRv2__0148 (ppc)
Enzymes [BR:mgy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MGMSRv2__0148 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CDK97363
UniProt: V6EYR2
LinkDB All DBs
Position
140305..143106
Genome map
AA seq 933 aa AA seqDB search
MQRVDDKNLRARVKLFGNILGTVLAEQERPQVLETVEALRKGFIDLRQHEDPAKRRALMR
LIGALDPHTLSHVVRAFATYFLLANIAEEDFANQQRRRHVQSGERLWYGSFDDTLRQLKA
EGVSAGQLQQMLDALRFQPVFTAHPTEAKRRAVLEAQRRLYVLARRLNDPNLAEHQRRSL
DQQILNQVQVLWKTDEVRIQKPVVEDEIKNGLFYFRETLFDTVPRVYRNLERALDNVYAD
EGGAKAFRVPAFLRFGSWIGGDRDGNPFVTHDVTKMAVRLQSREVLKHYRRRIEELQVQL
THSASLVRPSPVFEARMTADEDIVAEAFGAKPGRYAFEPYRRKLHLMHYRLGRQIARIET
LLDGGSDPGRGAGYGSEDDLLADLLAISDSLISHGDSNVAAAELQDMIALVRTFGFFLAE
LDIRQESSRHTQAVAELFAKAPNLPDYNELNESARVGVLADLLSHAGTPLLYAQDLSDGT
REILRVMRTMADLRREISPRAFGAYVISMTHQASHVLEVLFLASFAGLCGRHQDGSWHCD
IRVAPLFETIDDLAKIEPTLEQLLDVGTYRALLKQSGNIQEVMLGYSDSCKDGGILASSW
SLYKAQRLISRSTETRGLACRVFHGRGGSVGRGGGPTHDAILAQPPGTVNGDIKFTEQGE
VLSAKYSNADTATYELTMGVSGLIKASRCMSVACTPDRADFIEIMDDLAQRGEASYRDLT
DRTPGFIDYFYEGTPVAEIGLLNIGSRPSHRSKGDRSKYSVRAIPWVFAWAQSRQTIPAW
YGIGSALKGWRGDDAERLQTLRAMVREWPFFRALLSNSAMSLSKSEMSIAREYADLCGEA
GGSVFDRIQAEFNESNTQMLEVFEADELLGDNRQLAMSLARRNPYLDPINHIQIIALRHY
RDAPESDQAERLRWQLPLLRSINALAAGMRNTG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtgtcgatgacaagaatttgcgggccagggtcaagctgttcggcaatatcctg
ggtacagtcctggccgaacaggaacgcccgcaggttctggagacggtggaagccctgcgc
aagggtttcatcgacctgcgccagcacgaagacccggccaagcgccgggcgttgatgcgg
ctgatcggcgcgcttgatccgcacaccctgtcccatgtggtgcgcgcctttgccacctat
ttcctcctcgccaatatcgccgaggaggatttcgccaaccagcagcgccgccgccacgtg
caaagcggcgagcggctgtggtacggctcgttcgacgacaccttgcgccaattgaaggcc
gaaggggtgagcgccggccaattgcagcagatgctggacgcgctacgctttcagccggtg
ttcaccgcccacccgaccgaggccaagcgccgcgccgtgttggaagcccagcgccggctt
tacgtgctggcccggcgtctcaacgaccccaatctggccgagcatcaacgccggtcgctg
gatcagcagatcctcaatcaggtccaggtgttgtggaagaccgacgaggtccgcatccaa
aagccggtggtggaagacgagatcaagaacggcctgttctatttccgcgagactttgttc
gacaccgtgccccgggtctatcgcaacctggaacgcgcgctcgataacgtctatgccgac
gagggcggggccaaggccttccgcgttccggcctttttgcgcttcggctcgtggatcggc
ggtgaccgcgacggcaatcccttcgtcacccacgacgtcaccaagatggcggtgcggctg
caatcgcgcgaggtgctgaagcattatcgccgccgcatcgaggaattgcaggtgcagttg
actcattccgcctcgctggtcaggccgtcgccggtcttcgaggcgcgcatgaccgccgac
gaggacatcgtcgccgaagccttcggcgccaagccggggcgctatgccttcgagccctac
cggcgcaagctgcatctgatgcattatcgtctgggccgccagatcgcccgtatcgagacg
ctgttggacggcggcagcgaccccggacgcggcgccggctatgggtcggaagacgatctg
ctggccgatctgctggccatcagcgattcgctgatcagccacggcgattccaatgtcgcc
gccgccgagttgcaggacatgatcgccctggtccgcaccttcggctttttcctggccgag
ttggatattcggcaggaatcgtcgcgccatacccaggcggtggcggaattgttcgccaag
gcgcccaatctgcccgattacaacgagttgaacgaaagcgcccgtgtcggcgtgctggcc
gatctgctgtcccatgccggcacccctttgctctatgcccaggatttgtccgacggcacc
cgcgaaatcctgcgggtgatgcggaccatggctgatctgcggcgcgagatcagcccgcgc
gccttcggcgcctatgtgatttccatgacccatcaggccagccatgtgctggaggtgctg
tttctggccagcttcgccggcctgtgcggacgccatcaggacgggtcgtggcattgcgac
atccgggtggcgccgttgttcgagaccatcgatgatctggccaagatcgagccgaccttg
gagcaattgctggatgtcggcacctatcgggcgctgctcaagcaatcgggcaatatccag
gaagtgatgctgggctattcggattcgtgcaaggacggcggcatcctggcgtcgagctgg
agcctgtacaaggcccagcgcctgatcagccgcagcacggaaacccgagggctcgcctgc
cgggtgtttcatggccgcggcggttcggtgggcaggggcggtggtcccacccatgacgct
atcctggcgcagccgccgggtacggtgaacggcgatatcaagttcaccgagcagggcgag
gtgctgtcggccaagtattccaatgccgacaccgccacctatgaactgaccatgggggtg
tcggggctgatcaaggccagccgctgcatgagcgtcgcctgtacccccgaccgtgccgat
ttcatcgagatcatggacgatctggcccagcgcggcgaggccagctatcgcgacctcacc
gatcgcacccccggctttatcgattatttctatgaaggcaccccggtggcggaaatcggc
ctgttgaacatcggttcgcgcccgtcgcaccggtccaagggcgatcggtcgaaatattcg
gtgcgcgccattccctgggtgttcgcctgggcgcaatcgcgtcagaccatccccgcctgg
tatggcatcggcagtgcgttgaagggctggcgcggcgacgatgccgagcggctgcaaacc
ttgcgggccatggtgcgtgaatggccgttcttccgcgcgctgttgtccaatagcgccatg
tcgctgtccaagtcggaaatgtccatcgcccgtgaatacgcggatttgtgcggtgaggcc
gggggcagcgtttttgaccgcatccaggccgagttcaacgagtccaacacccagatgctg
gaggtgttcgaggctgacgaattgctgggcgacaaccggcaactggccatgtcgctggcc
cggcgcaacccctatctggaccccatcaaccacatccagatcatcgcgttgcggcattat
cgtgatgcgccggaaagcgatcaagcggaacgcctgcgctggcaattgccgttgctgcgc
tccatcaacgccctggcggcggggatgcgcaataccgggtga

DBGET integrated database retrieval system