KEGG   Magnetospirillum gryphiswaldense: MGMSRv2__1221Help
Entry
MGMSRv2__1221     CDS       T02960                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, iron/manganese cofactor
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mgy  Magnetospirillum gryphiswaldense
Brite
Enzymes [BR:mgy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MGMSRv2__1221 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1266116..1266712
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYDKTALEPHISAQTLDFHHGKHHNAYVTNLNNLVKDTDLAAKSLEEIIAIA
AKDLPAKQGVFNNAAQVWNHTFFWNCMKQGGGGKPTGTVLAKIEAAFGSYEKFAEEFKNA
AVTQFGSGWAWLVEENGALKITKTANADLPLAHGQKALLTVDVWEHAYYLDFQNRRPDFV
QTFLDKLVNWDFVAKNLG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgagcttcccccgcttccctatgacaagaccgctctggaaccccatatctcg
gcccagacgctggacttccaccatggcaagcatcacaacgcctatgtgaccaacctgaac
aatctggtgaaggacaccgatctggcggccaagtcgctggaagagatcatcgccatcgcc
gccaaggatctgccggccaagcagggcgtgttcaacaacgccgcccaggtgtggaaccac
accttcttctggaattgcatgaagcagggcggcggcggcaagcccaccggcaccgtgctg
gccaagatcgaggccgccttcgggtcctacgaaaagttcgccgaggaattcaagaacgcc
gctgtgacccagttcggctcgggctgggcctggctggtggaagaaaacggcgcgctcaag
atcaccaagaccgccaatgccgacctgcccctggcccacggccagaaggcgctgttgacg
gtggacgtgtgggaacacgcctattacctggatttccagaaccgccgccccgatttcgtc
cagaccttcctggacaagctggtgaactgggatttcgtcgccaagaacctgggctga

DBGET integrated database retrieval system