KEGG   Mannheimia haemolytica USDA-ARS-USMARC-184: B824_24590Help
Entry
B824_24590        CDS       T03786                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
mhat  Mannheimia haemolytica USDA-ARS-USMARC-184
Brite
Translation factors [BR:mhat03012]
 Eukaryotic Type
  Elongation factors
   B824_24590
 Prokaryotic Type
   B824_24590
Mitochondrial biogenesis [BR:mhat03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B824_24590
Exosome [BR:mhat04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B824_24590
  Exosomal proteins of breast cancer cells
   B824_24590
  Exosomal proteins of colorectal cancer cells
   B824_24590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2485953..2487137)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHFGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENVGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaatgtgggtacaatcggccac
gttgaccatggtaaaacaactttaacagcagcaatcactaccgtattagcaaaacacttc
ggtggtgcagctcgtgcatttgaccaaatcgataacgcgccagaagaaaaagcgcgtggt
atcactatcaacacttcacacgttgagtacgatacagcaactcgtcactacgcacacgtt
gactgcccgggacacgcggactatgttaaaaacatgattaccggtgcggcacaaatggac
ggtgctatcttagtagtagcggcaacagacggtccaatgccacaaactcgtgagcacatc
ttattaggtcgccaagtaggtgtaccatacatcatcgtattcttaaacaaatgcgatatg
gtagatgatgaagagttattagaattagttgagatggaagtgcgtgaacttctttcacaa
tacgacttcccgggtgatgacactccaatcgtacgtggttcagcgttacaagcgttaaac
ggcgttgctgaatgggaagagaaaatccttgaattagcaaaccacttagacacatacatt
ccagagcctgagcgtgcgattgataaaccattcttattaccaatcgaagacgtattctca
atttcaggtcgtggtacagtagtaacaggtcgtgttgagcgtggtatcatccgcactggt
gatgaagttgaaatcgtaggtatcaaagatacagcgaaaacaaccgtaacaggtgttgag
atgttccgtaaattattagacgaaggtcgtgcgggtgagaacgtaggtgcattattacgt
ggtactaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccgggttcaatcact
ccacacacagacttcgaatcagaagtttacgtattatcaaaagaagaaggtggtcgtcac
actccattcttcaaaggttaccgtccacagttctacttccgtacaacggacgtaacaggt
acaatcgaattaccggaaggtgtagagatggtaatgcctggcgacaacatcaaaatgact
gttagcctaattcacccaatcgcaatggacgaaggtttacgttttgcgattcgtgaaggt
ggtcgtacagtaggtgcgggcgttgtagcgaaaatcatcaaataa

DBGET integrated database retrieval system