KEGG   Methanohalophilus halophilus: BHR79_00570Help
Entry
BHR79_00570       CDS       T04572                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mhaz  Methanohalophilus halophilus
Pathway
mhaz03030  DNA replication
mhaz03410  Base excision repair
mhaz03420  Nucleotide excision repair
mhaz03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mhaz00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BHR79_00570
   03410 Base excision repair
    BHR79_00570
   03420 Nucleotide excision repair
    BHR79_00570
   03430 Mismatch repair
    BHR79_00570
Enzymes [BR:mhaz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BHR79_00570
    6.5.1.6  DNA ligase (ATP or NAD+)
     BHR79_00570
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BHR79_00570
DNA replication proteins [BR:mhaz03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BHR79_00570
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BHR79_00570
DNA repair and recombination proteins [BR:mhaz03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BHR79_00570
   NER (nucleotide excision repair)
    Other NER factors
     BHR79_00570
   MMR (mismatch exicision repair)
    Other MMR factors
     BHR79_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: APH38121
UniProt: A0A1L3Q037
LinkDB All DBs
Position
113607..115292
Genome map
AA seq 561 aa AA seqDB search
MTSFEYFANTCASIEQIPGSLEMTDVIAKLLKKVTIEELPVVTHFIMGSVFPAWSDRQMG
VGNRLLYTALSKSSGVSEEEIENIIRKTGDIGETAVQALSSNPAGQSTFSAFIEERPGME
IKEVYERFTHIADTTGKRSQGTKIKNLQYLFNSATPIEARYLARLAIEQLRIGVGEGIVR
DAISKAFETDVAAVERAFMLTNDLGLVAVAACNGGNEEVQKLDIQLNRPVKMMLAQVTPS
IQSALNDLGEVAVEWKFDGARVQIHKEGDNIHIFSRRLENVTSSLPDVVKAVQENVNADT
AILEGEAVAIGEDGKPRAFQDILKRFRRKYDVEAIAKAIPLKLNLFDVLYLNGESLIDNP
LRKRRELLFQNVQGSDMILVDRQVITDNEEEIEEIYADALRGGHEGIMIKKPDAPYSPGK
RGKNWLKKKPLMETLDLVVIGAEWGYGRRANLIGSYALGCYDPDTGKFPAIGKVATGITD
EKLAELTTLFSDLIVYESGRKIELKPEIVFEIAFEEIQKSPNYESGYALRFPRLVNVRDD
KSPEEAESLERIGEIYHSQRS
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcttttgaatattttgcaaatacatgtgcaagtatcgaacagatcccaggttca
ctggaaatgaccgatgtgattgcaaaactcctaaaaaaggtcacaattgaagaacttcct
gttgtgacccattttataatgggttcggtttttcctgcctggagtgacaggcagatgggt
gtcgggaacaggctcctatataccgccctgtcaaaatcatcaggggtttcagaggaggaa
atagaaaatatcatccgtaaaaccggggatataggggaaacagcagtacaggccctgtcc
tccaatcctgccggacagtccacattctcagcatttattgaagaaagacccggcatggag
atcaaagaagtttatgaaaggttcacccatattgcagatactacagggaaacgttcccaa
ggtaccaaaataaaaaatctacagtaccttttcaattcggcaacccctatagaggcacgt
tatctggcccggcttgctatcgaacagctacgtattggtgtgggagaaggaatcgtcagg
gacgcgatatccaaagcttttgaaactgatgtagccgcagtcgagcgggcattcatgctg
acaaacgacctgggacttgttgccgttgcagcctgcaatggtggcaatgaagaagtacag
aaacttgacatccagctgaatcgcccggtaaaaatgatgctggcacaggtaacacccagt
atccagtcagccctgaatgacctcggagaagttgctgtagaatggaagtttgacggggca
agggtgcagatacataaagaaggagataacatacatatattctcccgcaggcttgagaat
gtaacatcctccctgcccgatgtagtaaaagcagtgcaggaaaatgtgaatgcagacacg
gccattctagaaggagaagcagtggcaattggagaggatggcaaaccccgggcattccag
gacatacttaagcggttcagaagaaaatatgacgttgaagcaattgcaaaagcaatccct
ctcaaactaaacctctttgacgtgctctaccttaacggggaaagcctgatagacaaccct
ctcaggaaaagaagagagttattgttccagaatgtccagggcagtgacatgatacttgta
gacaggcaggtaattaccgataatgaggaagaaatagaggaaatctatgcagatgccctc
aggggagggcatgaaggaataatgattaaaaagcccgatgcaccttattcccctggtaaa
aggggcaagaattggctcaagaaaaaaccactcatggaaaccctggaccttgtagttatc
ggtgctgagtggggatatggacggcgggcaaacctgattggttcctatgcacttggttgt
tatgatccggacacagggaaattccctgctattggtaaggttgccaccgggattacagac
gaaaaactggcagaacttaccactcttttttctgatttgattgtttatgaatcgggcaga
aaaatagaattaaaacccgaaattgtctttgagattgcttttgaagagatacaaaagagt
cccaattatgaatccggatatgccctgcgttttcccaggcttgttaatgtgagagatgat
aaatcccctgaagaagcagagagcctggaaaggattggggagatataccactcccagaga
tcctga

DBGET integrated database retrieval system