KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY1017Help
Entry
MARHY1017         CDS       T02083                                 

Gene name
davT
Definition
(GenBank) Delta-aminovalerate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00250  Alanine, aspartate and glutamate metabolism
mhc00410  beta-Alanine metabolism
mhc00640  Propanoate metabolism
mhc00650  Butanoate metabolism
mhc01100  Metabolic pathways
mhc01120  Microbial metabolism in diverse environments
Module
mhc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mhc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MARHY1017 (davT)
   00650 Butanoate metabolism
    MARHY1017 (davT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MARHY1017 (davT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MARHY1017 (davT)
Enzymes [BR:mhc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MARHY1017 (davT)
Amino acid related enzymes [BR:mhc01007]
 Aminotransferase (transaminase)
  Class III
   MARHY1017 (davT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCG94497
UniProt: H8W7P9
LinkDB All DBs
Position
complement(1064883..1066142)
Genome map
AA seq 419 aa AA seqDB search
MTDHKGKLSPLLKQATGITAAKGEGAYIIDPEGRRYLDFTSGIGVTSTGHCHPKVVEAAQ
KQVATMIHAQATTVMNPRLPELAEKLGAVTPDPLNAFFFSNAGTEVAEGAIRLVRQATGR
PNVIVFHGGFHGRTMGSLSMTTSSVGLRAGVSPMMGGVVVAPFPHAFHYGWSLDEATDFC
LRELDRIFVTYSAPKETAAMLIEPVQGEGGYVPANARFMQGLRERCDKHGIMLVFDEVQA
GFGRSGKFWAHEHFGVTPDAIMIAKGLASGFPISALAASEETMAKGWPGSQGGTYGGNAV
AAAAAIATIDVIQEEGLVQNADAMGKRLWDNLHSLKKDYPEMADVRGKGLMVGVEMRRGD
CPDGERAGKILKECEKRGLLMLRCGPYQEIVRWLPPLIVNQQQIDEATGIFEEALKATA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacaaaggcaaactgtcccccctgctcaagcaggctaccggcatcaccgct
gccaaaggcgaaggtgcctatatcattgaccctgaaggtcgccgttacctggactttaca
tccggcattggtgtcaccagtaccgggcactgtcacccgaaagtggtggaagccgcccag
aaacaggtagccaccatgatccatgcccaggccaccacagtcatgaacccgagactacct
gaactggcagaaaaactcggcgcagtgaccccggatccgctgaatgcctttttcttttcc
aatgccggcaccgaagttgccgaaggtgccatccgcctggtgcgccaggccaccggtcgc
cccaatgtgatcgtattccatggcggctttcatggtcgcaccatgggctcactgtccatg
accacctccagcgtgggcctgcgagccggtgtcagcccgatgatggggggtgtggtcgtc
gcgccattcccccacgccttccattacggctggagcctggatgaggccacggacttctgc
ctgagagagctggatcgcatcttcgtgacctattccgcccccaaggaaaccgcggccatg
ctgattgagccggttcagggcgagggtggctatgtgccggccaacgctcgttttatgcag
gggttgcgggagcgctgcgacaagcacggcatcatgctggtgtttgacgaagtacaggcc
gggttcggccgcagcggcaagttctgggcccacgaacacttcggggtaacacccgacgcc
atcatgatcgccaaaggcctggccagcggcttccccatttctgctctggcggcttcagaa
gaaaccatggccaagggctggccgggttctcagggcggcacctatggcggcaacgctgta
gcggcggctgccgccatagcaaccatcgacgtgattcaggaagagggcctggtgcagaac
gccgatgcgatgggcaaacgcctgtgggacaacctgcacagtttgaaaaaggactacccg
gaaatggcggatgtccggggcaaaggcctgatggttggcgtggaaatgcgccgcggagac
tgcccggacggagaacgcgccggcaagatcctgaaagaatgtgaaaaacgggggctgctg
atgctgcggtgtggcccataccaggaaatagtgcgctggctgccgccgctgatcgtcaac
cagcaacagattgacgaagccaccggcatcttcgaagaggcactgaaagccacggcctga

DBGET integrated database retrieval system