KEGG   Methanosarcina horonobensis: MSHOH_1759Help
Entry
MSHOH_1759        CDS       T03933                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, archaeal
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mhor  Methanosarcina horonobensis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mhor00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSHOH_1759
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSHOH_1759
   00680 Methane metabolism
    MSHOH_1759
Enzymes [BR:mhor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MSHOH_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2128703..2130283)
Genome map
AA seq 526 aa AA seqDB search
MSRKATYPKVMCTQHPDSASKYISTQEEPGEAIEAAVVFGCDEYMPDYEGKATPYHQNVQ
IVSKFIEETDLIPGKDIFITPRAPSAAQENRFRQLMVMMSIAEANYGAVEYSDVQAINEF
VHPMTATVGEILDAQQHMVDVGELAKKEFGVAMEVPRIIPLIEDAPALLHAKELVKSTIL
SWEERFGTAPEKFRVFLGKSDSALSFGHVASTLSCKYAISGISELNSELDTGTGIIFGAG
TLPFRGNLNLKNAENFFREYRGISTITLQSAVRYSHGKGEAEALVRLAEARLPESPNIYS
SEEKEEIINLIGVFGTRYSRIIRELSPAINQLACLLPQQRDRLMHKGTGGYSRNAPDISC
LVSLCRSDIGKELETSMPSEDLHLPRAIKFTGALYSIGLPPEFIGTGTALEEAREKLGEE
TCERLLTKYFPSLGSDLSFASGYLDLNVASRFISEACLKEVRKDIEVLSDTFNLKVRPEP
SYRILLEMMQPDLLQAGTAGNCMDEEVSQLVCSTLTKMGKIRKALG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaaagcaacctatcctaaagtaatgtgcacgcagcacccggactctgcatca
aagtatatctccacgcaggaagaacccggtgaagccattgaagctgcagtggtattcggc
tgtgatgaatatatgccggattatgaagggaaggcgacaccttaccaccagaacgtccag
atagtatcaaaattcatagaagaaacagacctgatacccggaaaagacatttttatcact
ccgagggctccgagtgcagcgcaggaaaatcgcttcaggcagcttatggtcatgatgtcc
attgccgaagccaattacggagccgttgaatactcggatgtgcaggcaattaacgaattc
gtgcaccccatgacagctacggtaggagagatccttgatgctcagcagcacatggtagat
gtgggcgagcttgcaaaaaaggaattcggggttgcaatggaagtcccgcgtataattccc
cttatagaagacgctcctgcccttcttcatgcaaaggaactggtaaaaagtacgatcctt
tcctgggaagaacgcttcggaacagcacctgaaaagttcagggtcttcctgggcaagtcc
gactctgctctctctttcggacatgtggcaagcacactctcgtgcaaatacgccataagc
ggaatttccgaactgaactcggaactcgataccggcacaggcatcatattcggagcaggg
actctacctttcaggggaaacctgaacctgaaaaacgcggaaaacttcttcagagagtac
aggggcataagtacaatcaccctgcagtcagctgtcaggtacagccatggaaaaggagaa
gctgaagctcttgtccgtcttgcagaggcaaggcttccggaatctccaaatatctattcc
agtgaagagaaagaagaaattataaaccttataggagttttcgggacaaggtatagccgc
attatccgtgaactgtcccctgccataaaccagctcgcatgtctcctcccccagcagcgg
gaccgtctgatgcataaaggaacaggcggttattcgagaaacgctccggatatctcatgc
cttgtaagtctctgccgcagtgatatcggaaaagagctcgaaacgagcatgccttcggaa
gatctgcacctgccacgagctataaagttcaccggcgccctctactcaataggcctgcct
cccgaatttataggcacaggcactgcccttgaagaagcccgggaaaaactcggcgaggaa
acctgtgaaagactacttactaaatattttccttcccttggcagcgacctgagttttgct
tccggttacctggacctgaatgtagcctcccgcttcatttcagaggcctgcctgaaagaa
gtccgtaaagacattgaggttttgagcgacacattcaaccttaaagtcagacccgaaccc
tcataccgcatcctgctcgaaatgatgcagcccgaccttctgcaggcagggacagcagga
aactgcatggatgaagaagtctcgcagcttgtatgctcgacccttaccaaaatgggaaaa
attagaaaggctctgggttaa

DBGET integrated database retrieval system