KEGG   Methanospirillum hungatei: Mhun_0836Help
Entry
Mhun_0836         CDS       T00325                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00500  Starch and sucrose metabolism
mhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mhun_0836
Enzymes [BR:mhu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mhun_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 CRAL_TRIO
Motif
Other DBs
NCBI-ProteinID: ABD40588
JGI: Mhun0836
UniProt: Q2FR74
LinkDB All DBs
Position
943883..945337
Genome map
AA seq 484 aa AA seqDB search
MNQRFCIGFEVHQPYRLKKGFKPDFADGPDDPMERYFDDANKEILLRVCDKCYEPATSII
LDQLDDGFCCAFSLSGVLIEQMEKWAPDVLDLFRQAAQHKNVEMIGQTYFHSISSLFWTM
DEFCNQVNLHRDLLKDVFGVTPQVFENTEFLFDNRIAATVKDLGFKACFTEGVDYILEWR
SPNYLYQCAGLPVIMRNFKLSDDIAFRFTCRDWEAWPLTADRYANWVSRTPGDFVPVFID
YETIGEHYWVESGIHEFFRHLGPEMRRSEVQMVKPSDLLSFPVHDEFSIPLPISWADAEK
DGTAWIENRKQKNAFRSVQRAESFCKDKHTWRCMQISDHFYYMSCKHGSCGEVHTYFSHQ
PEHEAFITYMDVLADFIERSIPEMDKKEYLYPLRTIPIDNAFYFSSPVGYTGHVAFDMDQ
FADMLQIVPSDSITYHHQKGDFASWCRNVIKDEPLAQAIEKARNRQELILAADTRRHELW
TALK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcgattttgtatcgggtttgaagttcatcagccatatcggcttaaaaaagga
ttcaaacctgatttcgcggacggtccggatgatccgatggagcgctacttcgatgacgcc
aataaagagatcctgctccgggtatgtgataaatgctatgaaccggctacatctatcatt
cttgatcaactggatgacggtttttgctgtgcattctctctctccggagtacttatagaa
cagatggagaaatgggcacctgatgttcttgatctcttcagacaggcggcacagcataaa
aatgtcgagatgatcgggcagacctattttcacagcatctccagcctgttctggaccatg
gatgaattctgcaatcaggtgaacctccatcgtgacctcctcaaagacgtgttcggagta
actcctcaggtatttgaaaatacagaatttctctttgataaccggattgctgccacggta
aaagatctcgggtttaaagcctgctttactgaaggtgtagattatatacttgaatggcga
agtccgaattacctgtatcagtgtgccggtctaccggtcatcatgcgcaattttaaactt
tcagatgacattgcgtttcggtttacctgccgggactgggaagcctggccactgactgct
gatcggtatgcaaactgggtctcacgaactccgggtgattttgtaccggtatttatcgac
tacgagaccatcggtgaacattactgggtagagtccggaatccatgaatttttcagacat
ctgggtccggagatgagaagatcagaggtccaaatggtaaaaccttcagatctgttatcc
ttcccggtacatgatgaattttcaattcctctccccatctcctgggccgatgccgaaaag
gatggtacagcctggattgaaaaccgaaaacagaagaatgcattcagatcagtgcagcgt
gcagaatcattctgtaaagataaacatacctggcggtgtatgcagattagtgatcatttc
tactatatgtcatgtaaacatggatcgtgtggagaagtccatacctacttcagtcatcag
ccggaacatgaagcatttattacctatatggatgtcctggcagattttatcgaacgctcc
atacccgaaatggacaaaaaggagtacctctatccactccgtaccattccaatcgataat
gccttctacttctcaagtccggtcggatacaccggtcatgtcgcctttgatatggatcag
tttgccgatatgcttcagattgttccatcagactcgatcacatatcaccatcagaaaggc
gattttgccagctggtgtcggaatgtcataaaggatgagccactggcacaggctatcgaa
aaagcccggaaccggcaggaactgatactggctgcagatacccgaagacatgaattatgg
accgctttaaaataa

DBGET integrated database retrieval system