KEGG   Mycobacterium intracellulare ATCC 13950: OCU_29800Help
Entry
OCU_29800         CDS       T02158                                 

Definition
(GenBank) DNA polymerase LigD ligase subunit
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3169571..3170569
Genome map
AA seq 332 aa AA seqDB search
MTDFASLPGAVREALYDEPVPDWRSPTLATLTDDRFSDPHWIFERKFDGMRCLAFRDGDR
VRLLSRNRQPLNGTYPELVDALAAQPVTRFVVDGEVVAFDGRRTSFARLQGRLGLTDPDV
ARASPVRVFYYVFDLLHLDGMSTVEVPLLWRKRLLRKAIDFADPLRCAPHRVGDGIAAYR
RACERGDEGVIAKRADSTYQGGRSKNWLKFKCVRDQEFVVGGYTSPKGSRVELGALMLGY
YEGGDLVYAGKVGTGFDDATLRRLHARLSPITRDTPPFARGLVREAGANWVSPEMVVQIG
FSEWTRDGKLRHPRYLGMRTDKEPGEVVRETH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttcgcgagcctgcccggtgcggtgcgcgaagcgctgtacgacgaacccgtg
cccgactggcgctcgcccaccctggccaccctcaccgacgaccggttctccgatccgcac
tggatcttcgagcgcaagttcgacggcatgcgctgcctggcgttccgcgacggcgatcgg
gtccggctgttgtcgcgaaatcgtcagccgctcaatggaacctatcccgaattggtggat
gcgcttgccgcccaaccggtcacgcggttcgtcgtggacggagaggtggtggccttcgac
ggccggcggaccagcttcgcccggctgcagggtcggctgggcctcaccgatcccgacgtg
gcccgggcgtcgccggtgcgtgtattctactacgtattcgatctgctgcatctcgacggc
atgtccaccgtcgaggtgccgctcctctggcgaaagaggttgctgcgcaaagcgatcgac
ttcgccgacccgctgcgctgtgcgccgcaccgcgtcggggacgggatcgccgcctaccgg
cgcgcatgtgagcgcggggacgagggagtgatcgccaagcgggccgactccacctaccag
ggcggtcgctcgaagaactggctgaagttcaaatgcgtgcgcgatcaggagttcgtggtg
gggggctacaccagtcccaagggcagtcgagtcgagttgggcgccctgatgctcggctac
tacgagggcggcgacctggtctacgcgggcaaggtcggcaccggtttcgacgacgccacg
ctgcgccggctgcacgcgcgcctgtcaccgatcacccgggacacgccgccgttcgcccgc
ggtttggtgcgcgaggccggcgcgaactgggtatcccccgagatggtggttcagatcgga
ttcagcgagtggacgcgtgatggcaagttgcgccatccgcgctacctcggcatgcgcacc
gacaaggagcccggcgaagtggtgcgggagacgcactga

DBGET integrated database retrieval system