KEGG   Mycobacterium intracellulare ATCC 13950: OCU_39110Help
Entry
OCU_39110         CDS       T02158                                 

Definition
(GenBank) catalase HPII
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCU_39110
  Amino acid metabolism
   00380 Tryptophan metabolism
    OCU_39110
Enzymes [BR:mia01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     OCU_39110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4135703..4137805
Genome map
AA seq 700 aa AA seqDB search
MATDQNPKQRDLDSARFRRDTGYLTTQQGVRVDHTDDSLSVGDRGPTLLEDFHAREKITH
FDHERIPERVVHARGAGAYGYFEPYDDALAQYTAARFLTTPGLQTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIPQAQSA
HDTLWDFVALQPETLHTIMWLMSDRALPRSYRMMQGFGVHTFRLVNDRGEGTFVKFHWKP
RLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESGQYPEWELGVQLVPEEDEFSFDFDLLD
ATKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPVAEVRTNQHDGYGQHAIPQGRSSYYKNTIGGGCPALADE
NVFRHYTQRLDGQTMRKRAESFENHYSQARMFWMSMTRVEAEHIVAAFAFELGKVEMPEI
RSAVVAQLARVDGELAAQVAAKLGLPAPPEEQVDTVTASPALSQVTDAGDTIESRKVAVL
AANGVDVVGTQRFIELMGQRGAVVEVLAPVAGGTLEGGSGGELPVDRSFTTMASVLYDAV
VVACGPRSIATLSNDGYAVHFVTEAYKHLKPIGAYGAGVDLLRTAGITNRLAEDTDVLND
QSVITTKAAADELPDRFVEEFAGALAQHRCWQRRTDPVPA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaccagaatcccaagcagcgcgacctggactccgcacgcttccgtcgggac
accggatacctgacgacccagcagggcgtgcgcgtcgaccacaccgacgattcgctgtcg
gtcggtgaccggggaccgacgctgctggaggactttcacgcccgggagaagatcactcac
ttcgaccacgagcgcatcccggagcgcgtggtgcacgcgcggggcgccggcgcctacggc
tatttcgaaccgtacgacgacgcgttggcgcaatacaccgcggcgagattcttgaccact
ccaggcttgcagaccccggtgttcgtgcgattctccacggtggccggctcgcggggttcg
gccgacaccgtgcgcgacgtgcgcggcttcgccaccaagttctacaccgaacaaggcaat
tacgacctggtgggcaacaacttcccggtgttcttcatccaggacggcatcaagttcccc
gatttcgtgcacgcggtgaaaccggagccgcacaacgagattccgcaggcgcagtcggcc
cacgacacgctctgggacttcgtggcgctgcagcccgagacgctgcacaccatcatgtgg
ctgatgtcggaccgggcattgccgcgtagctaccggatgatgcagggcttcggcgtgcac
accttccggttggtaaacgaccgcggcgagggcactttcgtgaagttccactggaagccg
cggctcggcgtgcactctctgatctgggacgaatgccaaaagatcgccggcaaagacccc
gattacaaccgccgcgacctgtgggaggccatcgagtcgggccagtacccggagtgggag
ctcggcgtccagctcgtgcccgaggaggacgagttcagcttcgatttcgatcttctcgac
gcgacgaaaatcattcccgaggaacaggttccggtgcgcccggtgggcaagatggtgctc
aaccgcaacccggacaacttcttcgccgagaccgagcaggtcgcgttccacacggcgaac
gtggtgcccggcatcgacttcaccaacgatccgctgctgcagttccgcaacttctcctac
ctggacacccaactgatccggctgggcggccccaacttcgcccagctgccgatcaatcgg
ccggtggccgaggtccggaccaaccagcacgacggctacggacagcacgcgattccgcag
ggccgctccagctactacaagaacaccatcggcggcggctgcccagcgctggccgacgag
aacgtgttccggcactacacccagcggctcgacgggcagaccatgcgtaagcgggccgag
tccttcgagaatcactacagccaggcgcggatgttctggatgagcatgacgcgcgtggag
gccgaacacatcgtcgccgcgttcgctttcgagctcggcaaggtggagatgcccgagatc
cgttcggcggtggtggcacagctcgcgcgggtcgacggcgagttggccgcccaggtggcc
gcgaagctggggcttcccgcgccgcccgaggagcaggtcgacacggtgaccgcctcaccg
gcgctgtcacaggtcaccgacgccggcgacaccatcgaatcgcgcaaggtcgccgtgctg
gccgccaacggcgtcgatgtggtggggacacagcgctttatcgagctgatgggacagcgc
ggggccgtggtcgaggtgttggcgccggtggccggcggcacgctggagggcgggtccggc
ggcgaactgcccgttgaccggtccttcacgacgatggcgtcggtgctctacgacgcggtc
gtggtggcgtgcgggccgcggtcgatcgcgacgctgtccaacgacgggtatgcggtgcac
ttcgtgaccgaggcctacaagcatctcaagcccatcggggcgtacggcgccggcgtcgac
ctgctgcgcaccgccggtatcaccaaccgcctcgccgaggacaccgacgtgctcaacgac
cagtccgtcatcaccaccaaggccgccgccgacgagttgcccgatcgcttcgtcgaggaa
ttcgccggcgcgctcgcccaacaccgttgctggcaacggcgcaccgacccggttccggcc
tag

DBGET integrated database retrieval system