KEGG   Microcoleus sp. PCC 7113: Mic7113_4767Help
Entry
Mic7113_4767      CDS       T02374                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mic7113_4767
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mic7113_4767
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mic7113_4767
   00680 Methane metabolism
    Mic7113_4767
Enzymes [BR:mic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mic7113_4767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5559354..5562506
Genome map
AA seq 1050 aa AA seqDB search
MSSLIHSSDQEIAASSTSELFLRHRLKVVEDLWGSVLLSECGQELVDLLKQLRDLCSPEG
QATDLPESSVPKVIEKLDLNAAIRASRAFALYFQLINIVEQHYEQRDQQLSRRATSKTST
SHQAVPPKQAFPKTNGNLAMGSSNMLNSETHNADPMADFLERSWQDNAASKRESGTFHWL
FPHLQQLNVPPQQIQRMIENLDIRLVFTAHPTEITRHTIRAKQRRIARILKQLDQAEEAT
RSLGLTSSWEIEGYTEQLMEEIRLWWRTDELHQFKPSVLDEVDYTLHYFQEVLFEAIPQL
YHRMKQALNSSFPWLTPPVHNFCKFGSWVGSDRDGNPSVTPQVTWETACYQRGLVLEKYM
QSVGTLINLLSLSLHWSDVLPELLDSLEQDRSQMPELYEQLAIRYRQEPYRLKLSYVQQR
LENTRDRNRRLYNLYDGKPLQQDLNETNNSGVYRSGAEFLAELRLIERSLAVTGLSCQEL
ENLICQVEIYGFNLAHLDIRQESSRHCDTINEIAEYLQILPKPYNELSEAERTQWLTAEL
KTRRPLIPAEAPFSEKTSETIETFRMLRQLQQEFGAQVCQTYIISMSHEASDLLEVLLLA
KEAGLYDPATGKSSVQVVPLFETVEDLKRAPGVMKSLFELPLYRACLAGGYEALNVEPCS
DHPQPTNMPSRGALSEQPSTLSPNLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALQKIAE
EYGISLRIFHGRGGSVGRGGGPAYEAILAQPGHSINGRIKITEQGEVLASKYSLPELALY
HLETVTTAVIQASLLRTGFDDIEPWTQIMEELATRSRAHYRDLIYEQPDLLDFFHQVTPI
QEISQLQISSRPSRRGGKKDFSSLRAIPWVFSWTQTRFLLPSWYGVGTALKAFLDEDPEE
NLKLLRYFYFKWPFFKMVVSKVEMTLAKVDLQIAHHYVRELSSPENLERFERLFDQIASE
FNLTRDLILSIAGHKRLLDGDPELQRSVQLRNGTIVPLGFLQVSLLKRLRQHSNQTASGT
IIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgagctccctcattcactcgtctgatcaggaaattgctgcctcttctacctccgaattg
tttctgcgccatcgtctcaaagttgtagaagatttatgggggtctgttctcctatccgaa
tgcggtcaggaactagttgatttactcaagcaactccgtgacttgtgttcgccagaggga
caagccaccgacttaccagaatcctctgtgcctaaggtaatcgaaaagcttgacctcaat
gcggcgatccgggcgtcacgagcgtttgctctttactttcaactcattaacattgtcgag
cagcattacgaacaacgcgatcaacagctttcacgacgcgctacttccaagacttctacc
tcccatcaagctgtgccgcctaagcaagccttcccgaaaacaaatgggaatttggcaatg
ggttccagcaacatgctgaattcagaaactcacaatgctgaccccatggcggattttctg
gaaagaagctggcaggataacgccgcctccaaacgagaatcaggcacgtttcattggcta
tttcctcacttacaacagttgaatgtgccaccgcagcaaattcagcggatgatcgaaaat
ctggatattcggttagtgttcaccgctcatcccacagaaatcacccgtcatacgatccga
gccaagcagcgacgcattgctcgcatcttaaaacagctagaccaagcagaggaagccact
cgctctttagggttaacctcgtcttgggaaattgagggttataccgaacaactcatggaa
gagattcgcctgtggtggcgcaccgatgagttacaccaattcaagcccagcgtgttggat
gaggtcgattacacactccactattttcaggaggtactgtttgaggcgattccccaactg
tatcaccggatgaagcaagccttaaactcgtctttcccttggcttacaccgccagtccac
aacttctgcaaatttggctcttgggtgggatcagaccgggatggtaacccttctgtaacc
cctcaagtgacctgggaaacagcctgttaccagcgtggcttagtcctcgaaaaatatatg
cagtcggtcgggactctgattaatttgttgagtctttctttacactggagtgatgtttta
ccggagttattagattctctagagcaagaccgctcccaaatgccagagctttacgaacag
ctagcgattcgctaccgacaagagccttaccgactcaaactctcctatgtgcagcaacgg
ttggaaaatacccgcgatcgcaaccgccgactgtacaatctttacgatggtaagcccctg
caacaagacctgaacgaaacgaacaattctggcgtttatcgctcaggggctgagtttctc
gcagaactgcggttgatcgagcgcagtttagccgtaaccgggttaagctgccaggagttg
gaaaatctgatttgtcaagtggaaatttatggctttaacttggcgcacctggatattcga
caagaaagcagccgccactgtgacacgatcaatgagattgcggaatacctgcaaattttg
cccaagccctacaatgagctatccgaggcagagcgaacccaatggctaacggctgaatta
aaaacccgacgccctctcattcctgcggaagcgcctttttccgagaaaacgagcgaaacc
attgagacgttccgcatgttgcggcagttgcaacaggagtttggtgcccaagtctgccaa
acctacatcatcagcatgagccacgaggccagcgatttgttggaagtattattactggcg
aaagaggcaggactctacgatccggcgacgggaaaaagcagcgtacaggttgtgcccctg
tttgaaaccgtggaagacttgaagcgtgcgcctggggtgatgaaatcgctgtttgagtta
ccgctgtatcgcgcctgcctagctggaggctatgaagcattaaacgttgaaccttgttcc
gatcacccgcaaccgaccaacatgccgtcgcgaggagcactcagcgaacaaccttcaacc
ctaagtcctaacctgcaagaggtgatgctgggctactcggacagtaataaagattcaggt
ttcttgagtagtaactgggaaattcataaagctcaaaaagcgcttcagaaaattgccgag
gagtacggtatatccttacgcatttttcacggacgtggggggtctgtcgggcgtggaggt
ggcccagcttatgaagctatcctcgcgcaacctggtcacagtatcaatggacgaattaag
attacagagcaaggggaggtattagcctctaagtactctcttcccgaattggctctttat
cacttggaaacggtgacaacagcggtgattcaagccagcttgctgcgaaccggctttgat
gatattgagccttggactcaaatcatggaagagttagcgacgcgatcgcgcgctcattac
cgcgacctgatttatgagcaacccgacctcctggatttctttcaccaagtcacccccatc
caagaaattagccaattgcaaattagctctcgtccttcgcgtcgggggggtaagaaagat
ttctccagtctccgggcgatcccttgggtgtttagctggactcaaacccgctttttactt
ccgagttggtatggtgtcggtacggccctgaaagcttttctggatgaagacccagaggag
aatttaaagctactacgttatttctacttcaaatggcccttcttcaaaatggttgtgtcc
aaagtcgagatgacgttggctaaggtcgatttacaaattgctcatcactatgtgcgcgaa
ttgtcaagtcccgaaaatttggaacgctttgagcgattgtttgatcagattgccagcgaa
ttcaacctgactcgtgacttaatcctctcgatcgcaggacacaaacgacttctcgatggc
gatccagagttgcaacgctcggtgcagttgcgtaacggcacaattgttcccctgggtttc
ttacaggtatccttgctaaaacgtctacgccaacacagcaaccagacggcatcgggaacc
atcatccactcccggtacagtaaaggtgagctcctgcgtggggctttgttaaccatcaac
ggtattgcggctgggatgcgaaatacaggttga

DBGET integrated database retrieval system