KEGG   Mycobacterium intracellulare 1956: LG41_01620Help
Entry
LG41_01620        CDS       T03407                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mie  Mycobacterium intracellulare 1956
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(328192..329262)
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVSPMLAKSVRAIPPHASYEPKWDGFRSICFRDGDDVELGSRNERPMTRYFPE
LVAAVRAELPERCVIDGEIVIATDHGLDFEALQQRIHPADSRVRMLAEATPASFIAFDLL
ALGGDDYTRRPFSERRAALVDAVGGSGRSIHVTPATTDLGTAQRWFDEFEGAGLDGVIAK
PLDVTYQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIG
AFPMAERRRLFAELQPLVTDFADHPWNWAAHEAGERTPRKNEYSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFSLGEIVPGLGPG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggacctccctgtcatgccgccggtgtcgccgatgctggccaagtcggttcgcgctatc
ccgccccacgcgtcgtacgagcccaagtgggacggattcaggtcgatctgtttccgcgac
ggcgacgacgtcgagctgggcagccgcaacgagcggccgatgacccgctactttccggag
ttggtcgccgcggtcagggccgagctgccggagcgctgcgtgatcgacggggagatcgtc
atcgccaccgaccacggcctggacttcgaggcgctgcagcaacgcattcacccggccgac
tcgcgggtgcggatgctcgccgaggcgacgcccgcgtccttcatcgcgttcgacctgctg
gcgctcggcggcgacgactacacccggcggccgttcagcgagcggcgggcggccctggtc
gatgcggtgggcggatcgggtcgctcgatccatgtcacgcccgcgacgaccgatctgggc
accgcgcagcgatggttcgacgagttcgagggcgccggcctcgatggcgtgatcgccaag
cccctggacgtcacctaccagccggacaagcgggtgatgttcaagatcaagcacgaacgg
accgcggactgtgtggtcgccggctatcgggtccacaagtccggcgccgacgcgatcggg
tcgctgttgctggggctctaccaggacgacgggcagctggcctcggtcggcgtcatcggc
gcgttcccgatggccgagcggcgccggctgttcgccgaactgcagccgctcgtcaccgac
ttcgcggaccatccgtggaactgggccgcccacgaggccggcgagcggacgccccgcaag
aacgaatactcgcgatggaacgccggcaaggacctctcgttcgtgccgctgcggcccgag
cgcgtggtcgaggtccgctacgaccacatggagggtcggcggtttcgccataccgcgcag
ttcaatcggtggcgtccggaccgcgacccgcgctcgtgcacctacgaacagctggaacag
ccggtgacgttcagcctcggcgagatcgtgccgggcctcggcccgggctga

DBGET integrated database retrieval system