KEGG   Micromonospora sp. L5: ML5_0459Help
Entry
ML5_0459          CDS       T01379                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mil  Micromonospora sp. L5
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mil00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    ML5_0459
Enzymes [BR:mil01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ML5_0459
DNA repair and recombination proteins [BR:mil03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ML5_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
467854..468762
Genome map
AA seq 302 aa AA seqDB search
MPSERLKVEVEGRPLELSNLDKVLFPKAGFTKGEVIDYYTRIAPVLLPHLSDRALTRIRF
PNGVDGGSFFEKNAPAATPGWVRTENLPAPGSTKGRETIDYVVCDELPTLVWLANLAALE
LHTPQWKIGAHPDMMVVDLDPGAPAALKQCCRVALLMRDRLASDGISSFPKTSGKKGMQL
CCPIAGTQDADFVSDYAKRIAQELEQAHPKLVVSKMAKNLRPGKIFIDWSQNNAAKTTVA
PYSLRAQSVPSVSTPLTWDEVEAGAAGKRPSTRPYTAGEVLKRVEKQGDLLAPLLDGGPE
LP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccctctgagcggttgaaggtcgaggtcgaggggcgcccactggagctgtccaacctg
gacaaggtgctgttcccgaaggccggcttcaccaagggcgaggtgatcgactactacacc
cggatcgccccggtgctgctgccgcacctgagcgaccgcgcgctgacccggatccggttc
cccaacggcgtcgacggcggctcgttcttcgagaagaacgcacccgccgcgacccccggt
tgggtacgcaccgagaacctgcccgcccccgggtccacgaaggggcgggagaccatcgac
tacgtggtctgcgacgagctgcccacactcgtgtggctggccaacctggccgcgcttgag
ctgcacactccgcagtggaagatcggcgcccacccggacatgatggtggtcgacctggac
ccgggcgccccggccgcgctcaagcagtgctgccgggtggcgctgctgatgcgcgaccgg
ctggcctccgacgggatttcctcgttcccgaagacgtccgggaagaagggcatgcagctc
tgctgccctatcgccggcacgcaggacgccgatttcgtctccgactacgccaagcgcatc
gcgcaggagctggagcaggcacacccgaagctggtcgtgtcgaagatggcgaagaacctg
cgccccggcaagatcttcatcgactggagtcagaacaacgcggcgaagacgactgtggcg
ccgtactcgctgcgggcccagtcggtgccctcggtgtccacgccgctgacctgggacgag
gtggaggccggggcggcggggaagcggccgtcgacgcggccgtacaccgctggtgaggtg
ctcaagcgggtggagaagcagggcgacctgctggcgccgctgctcgacggcggtcccgaa
ctgccgtga

DBGET integrated database retrieval system