KEGG   Micromonospora sp. L5: ML5_4086Help
Entry
ML5_4086          CDS       T01379                                 

Definition
(GenBank) Alanine--glyoxylate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mil  Micromonospora sp. L5
Pathway
mil00250  Alanine, aspartate and glutamate metabolism
mil00410  beta-Alanine metabolism
mil00640  Propanoate metabolism
mil00650  Butanoate metabolism
mil01100  Metabolic pathways
mil01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ML5_4086
   00650 Butanoate metabolism
    ML5_4086
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ML5_4086
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ML5_4086
Enzymes [BR:mil01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ML5_4086
Amino acid related enzymes [BR:mil01007]
 Aminotransferase (transaminase)
  Class III
   ML5_4086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADU09596
JGI: ML5_4086
LinkDB All DBs
Position
4312011..4313306
Genome map
AA seq 431 aa AA seqDB search
MTSDDLLARHRAVLPSWMPLYYAEPLELVAGSGRRVTDAAGRTYLDFFGGVLTTMVGHDI
PEIREAVERQLRTGLVHTSTLYLIRQQVELAEKIARLSGIPDARVFFTNSGTEANEAALL
VATNHRRSHQILAVRNSYHGRSYATMGVTGNRGWSASALNPLQVAWLHSGERLRGLLARL
DAADRVDAAVEDLREVLATQTAGDVACLIAEPVQGVGGFVHGPDGLFAAWKKVLDEHGIL
LISDEVQTGWGRTGEHFWGYQAHGVTPDLLTFAKGIGNGFALAGVVGRAEVLESVPAISF
STFGGNPVSTAAGNAVLDYLLDHDLQGNAARVGAILGDGLRAAVAGLEQVAEVRGKGLML
AVEFVHPGTVEPDAELTTRVFEACRAGGLLVGKGGLYGNVIRMGPPLTLTEDEAREGLTI
MVDAIRASIEA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgacgacctgctggcccggcaccgggccgtgctcccctcctggatgccgctc
tactatgccgaaccgctggaactcgtcgccggttccggccgccgggtcaccgacgcggcc
ggccggacctatctggacttcttcggcggggtgctgaccacgatggtcggccacgacatc
ccggagatccgggaggcggtcgagcgacagctgcggaccgggctcgtgcacacctcgacg
ctctacctgatccggcagcaggtcgagctggccgagaagatcgcccggctctccggcatc
ccggacgcccgcgtgttcttcaccaactccggcaccgaggcgaacgaggccgcgctgctg
gtcgccacgaaccaccggcgctcgcaccagatcctcgcggtgcgcaacagctaccacggc
cggtcgtacgcgacgatgggcgtcaccggcaaccgcggctggtcggccagcgccctcaac
ccgttgcaggtggcctggctgcactccggtgaacggctgcgcggactgctggcccggctc
gacgccgccgaccgggtcgacgcggcggtcgaggacctgcgcgaggtgctcgccacccag
accgcgggcgacgtggcctgcctgatcgccgagccggtgcagggtgtcggtggcttcgtg
cacggaccggacgggctcttcgccgcctggaagaaggtgctcgacgagcacggcatcctg
ctgatcagcgacgaggtgcagaccgggtgggggcgtaccggcgagcacttctggggctac
caggcgcacggcgtgacgccggacctgctcacgttcgccaagggcatcggcaacgggttc
gcgctcgccggggtggtcggccgggccgaggtgctggagtcggtgccggcgatcagcttc
tccacgttcggcggcaacccggtctccaccgccgctggcaacgcggtgctcgactacctg
ctcgaccacgacctgcagggcaacgccgcccgggtcggcgcgatcctgggcgacggcctg
cgcgccgccgtcgccgggctggagcaggtcgccgaggtacgcggcaagggcctgatgctc
gccgtcgagttcgtccacccgggcaccgtcgagccggacgcggagctgaccacccgcgtc
ttcgaggcgtgccgggccggcggcctgctcgtgggcaagggcggcctctacggcaacgtg
atccggatgggcccgccgctgacgctcaccgaggacgaggcccgggagggcctgacgatc
atggtcgacgcgatccgcgcctcgatcgaggcgtga

DBGET integrated database retrieval system