KEGG   Microbacterium sp. CGR1: AKG07_02390Help
Entry
AKG07_02390       CDS       T04046                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mim  Microbacterium sp. CGR1
Pathway
mim00010  Glycolysis / Gluconeogenesis
mim00030  Pentose phosphate pathway
mim00051  Fructose and mannose metabolism
mim00052  Galactose metabolism
mim00680  Methane metabolism
mim01100  Metabolic pathways
mim01110  Biosynthesis of secondary metabolites
mim01120  Microbial metabolism in diverse environments
mim01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AKG07_02390
   00030 Pentose phosphate pathway
    AKG07_02390
   00051 Fructose and mannose metabolism
    AKG07_02390
   00052 Galactose metabolism
    AKG07_02390
  Energy metabolism
   00680 Methane metabolism
    AKG07_02390
Enzymes [BR:mim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AKG07_02390
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AKG07_02390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase UPF0261 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AKV85328
LinkDB All DBs
Position
518824..519852
Genome map
AA seq 342 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGIVLKGTTTYDLEFVGIRDGWRGVVDGDFFPLTRHEVKGL
SKVGGTILGTSRTNPYEGERGGAENIAKTLYGHKIDGIIAIGGEGTLAAADRLAKDGINV
IGVPKTIDNDLRATDYSFGFDTAVNIATDAMDRLRTTGDSHQRCMVAEVMGRHVGWIALH
AGMAAGAHAICIPEVPMSIDDITELVSSAHDRGRAPLVVVSEGFKLLGMDEAYSDKGLDA
FNRPRLGGIGDQLAPAIERITGIETRATILGHIQRGGSPSAFDRVLATRLGLHAADAIID
KAWGQMVAMQGTDIVRVPFAEALGELNTVPRSRYDEAAALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcattctgacgagcggcggcgactgccccggactcaacgcggtcatccgc
ggcatcgtgctcaagggcaccaccacctacgacctcgagttcgtcggcatccgcgacggc
tggcgcggcgtggtcgacggggacttcttcccgctcaccagacacgaggtgaagggcctg
tcgaaggtcggcggcacgatcctgggcaccagtcgcacgaacccgtacgagggtgagcgc
ggcggcgccgagaacatcgccaagacgctgtacggacacaagatcgacggcatcatcgcg
atcggcggcgaggggaccctcgcagcagccgaccgcctcgccaaggacggcatcaacgtc
atcggcgtgccgaagacgatcgacaacgacctgcgcgccacggactactcgttcgggttc
gacacggcggtcaacatcgccacggacgcgatggatcgtctgcgcaccacgggcgactcc
caccagcgctgcatggtcgccgaggtcatggggcgccacgtcggttggatcgcccttcac
gcgggcatggcagcgggcgctcacgccatctgcatccccgaagtccccatgtcgatcgac
gacatcaccgagctcgtctcgagcgcgcacgatcgcggtcgcgcaccgctcgtcgtcgtc
tccgaggggttcaagctgctcggtatggatgaggcctacagcgacaagggcctggacgca
ttcaaccgtcctcgactcggcggcatcggcgaccagctcgctccggcgatcgagcgcatc
acgggcatcgagacccgcgcgacgatcctcggccacatccagcgcggcggatcgccgtcg
gccttcgaccgcgtgctcgcgacgcgcctcggactccacgcggccgacgcgatcatcgac
aaggcatggggccagatggtcgcgatgcagggcacggacatcgtgcgcgtgccgttcgcc
gaggctctgggcgagctgaacaccgttccgcgcagccgctacgacgaggcagcagcgctc
ttcggctga

DBGET integrated database retrieval system