Microbacterium sp. No. 7: AOA12_02045 Help Entry AOA12_02045       CDS       T04102                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism mio  Microbacterium sp. No. 7 Brite KEGG Orthology (KO) [BR:mio00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mio03032]     AOA12_02045    03036 Chromosome and associated proteins [BR:mio03036]     AOA12_02045    03400 DNA repair and recombination proteins [BR:mio03400]     AOA12_02045 DNA replication proteins [BR:mio03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AOA12_02045 Chromosome and associated proteins [BR:mio03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AOA12_02045 DNA repair and recombination proteins [BR:mio03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AOA12_02045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF937 Motif Other DBs NCBI-ProteinID:  ALJ18758 UniProt:  A0A0P0DWG8 LinkDB All DBs Position 452680..452958 Genome browser AA seq 92 aa AA seqDB search MAITKTELVASIASATGESQAAVTRVVDGLFAAVSEAVAKGEKVSIPGWISFEQVDTAAR TGRNPQTGEEIKIAAGKRVKVTAGSKLKAAVK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggccatcaccaagaccgaactcgtcgccagcatcgcgagcgccacgggcgagagccag gctgccgtcacgcgtgtcgtcgacggcctgttcgccgccgtttccgaggccgtcgccaag ggcgagaaggtttcgatccccggctggatctcgttcgagcaggtcgacaccgccgcccgc accggccgcaacccccagaccggcgaggagatcaagatcgccgcgggcaagcgcgtcaag gtgaccgccggctcgaagctcaaggccgccgtcaagtaa

DBGET integrated database retrieval system