KEGG   Mitsuaria sp. 7: ABE85_01250Help
Entry
ABE85_01250       CDS       T04402                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
miu  Mitsuaria sp. 7
Brite
Enzymes [BR:miu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ABE85_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
266692..267276
Genome map
AA seq 194 aa AA seqDB search
MEHVLPELPYDKKALEPHISAETLEYHHGKHHKAYVDNLNNLQKGTEFESKTLEEIVKTS
SGGIYNNAAQIWNHTFFWSCMKPNGGGAPTGKLADAINAKWGSVDAFKEAFQKSAVGNFG
SGWTWLVKKADGTVDIVNMGAAGTPLTTGDTALLTIDVWEHAYYIDYRNARPKFVETFLK
SLLNWDFAQANFGN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaacacgtcctgcccgagctgccgtacgacaagaaggcgctggagccgcacatcagc
gccgagacgctggagtaccaccacggcaagcaccacaaggcctacgtggacaacctgaac
aacctgcagaagggcaccgagttcgagagcaagacgctggaagagatcgtcaagacctcc
agcggcggcatctacaacaacgccgcgcagatctggaaccacaccttcttctggtcctgc
atgaagcccaacggcggcggcgcgccgaccggcaagctggccgacgccatcaacgccaag
tggggcagcgtcgacgccttcaaggaagccttccagaagagcgccgtgggcaacttcggt
tccggctggacctggctggtgaagaaggccgacggcaccgtcgacatcgtcaacatgggc
gccgccggcaccccgctgacgaccggcgacaccgcgctgctgacgatcgacgtgtgggaa
cacgcctactacatcgactaccgcaacgcgcgtccgaagttcgtcgagaccttcctgaag
agtctgctgaactgggacttcgcccaggccaacttcggcaactga

DBGET integrated database retrieval system