KEGG   Mycobacterium immunogenum: BAB75_26280Help
Entry
BAB75_26280       CDS       T04755                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
miz  Mycobacterium immunogenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5317113..5318750)
Genome map
AA seq 545 aa AA seqDB search
MEANAPAMVSGAIDYPALLRLGLEQIDFYDSRSHLYALPGADMVTAIRIRASELTNRGLR
RGDRVAMIATSDEEYLATLLAVLLLGAVPCAIAPPPTPSRPESAGVAHLHAALAVLKPVM
VITQARGAAAVEHPNVVLYDELTDADPIDWQLLSPAGPGDIHHIQLTSGSTSAPKAVMLT
HSNVAHNSCAIAYGTRALRGRDRVFSWLPFYHDMGFIQVLSALLYGLRVGVMTPMGFLRD
PTSWIRHMSHHGSTHTAGPPFAYRAVSDALGRADMPAGVDLSSLRHAYVGAEPIPYAVMR
EVAERLAPLGLRADALVPCYGMAETVLATSIALQPHPLSRTAFGRVFGRANPDDGQLVVS
CGRAVDGLRLRILSPAGELLPDGAVGDIQVSGPSVMLGYLNPDGGVATPEDGWHDTGDRG
YLAAGELFVVGRRKEMLIVRGRNLPPYDVEREIDGLSGAGGVSVVFSLRDDQRGRESVIA
VVGTRVAVEEHEELRTRITGGVRAVFGFSLDDVVMVPARTIPRTTSGKRQRLTVRKAYLA
GQLGD
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
gtggaggccaacgcaccggcgatggtttcgggggcgatcgactatccggcgctgctccgc
ctggggctggaacagatcgatttctatgattcacgaagccatctgtatgcgctgccgggc
gcagatatggttactgccatacggattcgtgcgtctgagttgaccaatcgtggcctgcgg
cgcggtgaccgggtggcgatgattgccaccagcgacgaagagtacctggccacactgctg
gcggtgctgttgttgggcgccgtaccgtgcgccatcgcgcctccgcccactccctcgcgc
ccggaatcggccggagtggcgcatctgcacgccgcgctggcagtgttgaaaccggtcatg
gtgataacgcaggcgcggggcgcggcggcagtcgagcatccaaacgtggtgctgtacgac
gagttgactgatgccgatccgattgattggcagctactttcgccggccggacccggcgac
atccaccacatacaactcacctcgggctcgacatccgctccgaaggcagtgatgttgacc
cacagcaatgtggcgcataactcttgcgcaatcgcctacggcacgagggcattgcgtggg
cgagaccgggtgttcagctggctgccgttctatcacgatatgggctttatccaggtgttg
tccgcgctcctttacggtctgcgggtgggggtgatgaccccgatgggatttctgcgggat
ccgacatcctggatacggcacatgtctcatcatggatcgacccacacggcgggcccgcca
ttcgcctatcgagccgtatcggacgcgctcggtcgtgccgatatgcctgccggcgtggac
ttatcctccctgcgtcacgcgtacgtgggcgccgaacccattccctacgcagtgatgcgc
gaggttgccgagcggcttgccccgctgggattgcgggcagacgcactggtgccgtgctat
ggcatggcggagacggtactcgcgacaagcattgcactgcaaccgcatccgctgagccgg
acggcgttcgggcgagtgttcgggcgggcgaatccagacgacggtcagctggtggtgtct
tgcggccgggcggtggacggcctgcggctacgcatcctttcacccgcaggtgaattgctt
cccgatggtgccgtgggcgatatccaggtgagtggaccgtctgtgatgctcggctacctg
aatcctgacggtggggtggccacgcctgaggacggatggcacgacaccggagatcgtggt
tatctggctgccggggaactattcgtcgtgggccgacgcaaggaaatgctgatcgtgcgg
gggcgcaacttgccgccctatgacgtcgagcgtgagattgacggtctgtccggtgcgggt
ggcgtatccgtggtgttctccctgcgagatgatcaacgtggccgcgaatcggttatcgcc
gttgtcggcacccgggtagccgtggaggaacacgaggaactacgtacccgcatcaccggt
ggtgtccgcgcggtgttcggcttctcgctcgacgacgtcgtcatggtgccggcgcgtacg
atcccccggaccaccagcggaaaacgacaacgcctcacggtgcgtaaggcgtatctggcg
gggcagctgggagactga

DBGET integrated database retrieval system