KEGG   Mycobacterium sp. JLS: Mjls_5320Help
Entry
Mjls_5320         CDS       T00482                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
mjl  Mycobacterium sp. JLS
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
5572213..5573274
Genome map
AA seq 353 aa AA seqDB search
MQLPVSPPIAPMLSKAVADIPLGASYEPKWDGFRSIVFRDGDEVELGSRNERPMTRYFPE
LVEAARAELPARCVIDGEIVIATADGLDFEALQLRLHPAASRVRMLAEKTPASFIAFDLL
ALGDTDYTSRPFVERRAELERVLTGGHTFHVTPATVDVDTARRWFHEFEGAGLDGVIAKP
LDGPYLPDKRVMFKVKHQRTADCVVAGYRLHKSGDDAIGSLLLGLYTDDGELASVGVIGA
FPMARRRALFAELQPLVTTFDEHPWNWAAHADPDVVRRYGGGSRWNAGKDLSFVPLRPER
VVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYAQLEQPVTFRLGDIVPGLG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacttcccgtttcacccccgattgcgccgatgctgtcgaaggcggtcgcggacatc
ccgctcggcgcgtcctacgaacccaagtgggacgggttccggtcgatcgtgttccgcgac
ggcgacgaggtggaactcggcagccgcaacgagcggccgatgacccggtacttccccgaa
ctcgtcgaggcggcccgcgcggagctcccggcgcggtgtgtgatcgacggcgagatcgtc
atcgccaccgccgacggactggacttcgaggcgctgcagttgcggttgcatccggcggcg
tcgcgggtgcggatgctggccgagaagacgccggcgtcgttcatcgcgttcgacctgctt
gcgctgggcgacaccgactacacgtcgcggccgttcgtcgaacggcgggccgaacttgaa
cgcgtgctcaccggcggccacacattccacgtcacgccggccaccgtcgacgtcgacacg
gcacggcgctggttccacgaattcgagggcgccggcctcgacggggtgatcgccaaaccg
ctcgacggaccgtatctgccggacaagcgggtgatgttcaaggtcaaacaccagcgcacg
gccgactgcgtggtcgccgggtaccggctgcacaaatcgggcgacgacgccatcgggtcg
ctgctgctgggtctgtacaccgacgacggcgagctggcgtcggtgggcgtgatcggggcg
tttccgatggcgcggcggcgggccctgttcgccgagctgcagccgctggtgaccaccttc
gacgagcatccgtggaactgggccgcccacgccgatcccgacgtggtgcgccgctacggg
ggcgggtcgcgctggaacgcgggcaaggatctgtcgttcgtgccgttgcggcccgaacgg
gtggtcgaggtgcggtacgaccacatggaggggcggcgattccgccacaccgcccagttc
aaccgctggcgtcccgaccgcgacccgcgctcgtgcacctacgcgcaactcgagcagccg
gtcaccttccgcctcggcgacatcgtgccggggctcggctga

DBGET integrated database retrieval system