KEGG   Mycobacterium sp. JLS: Mjls_5423Help
Entry
Mjls_5423         CDS       T00482                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mjl  Mycobacterium sp. JLS
Brite
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Mjls_5423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABO01187
JGI: mjls5423
LinkDB All DBs
Position
5685660..5686283
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGANDALSKLAEARESGDHSAIF
LNEKNLAFHLGGHVNHTIWWKNLSPNGGDKPTGELAAALDDAFGSFDNFRAQFTAAANGL
QGSGWAVLGYDTLGQRLLTFQLFDQQANVPLGIIPLLQVDMWEHAYYLQYKNVKADYVKA
FWNVVNWEDVQNRFAKATSSASGIIVG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccttgcccgatcttgattacgattacggcgccctcgaaccgcacatc
tcggggcagatcaacgagcttcaccacagcaaacaccatgcgacgtatgtgaagggcgcc
aacgacgcgctgtccaagctggccgaggcgcgggagtccggagaccactccgcgatcttc
ctcaacgagaagaacctcgccttccatctgggtggacacgtcaaccacacgatctggtgg
aagaacctctcccccaacggtggcgacaagccgaccggtgagctggccgccgcgctcgac
gacgcgttcggttcgttcgacaatttccgcgcccagttcaccgccgccgccaacggcctg
cagggctccgggtgggcggttctcggatacgacacgctgggccagcggctgctgaccttc
caactgttcgaccagcaggccaacgtgccgctgggcatcatcccgctgctgcaggtcgac
atgtgggagcacgcctactacctgcagtacaagaacgtgaaggccgactacgtgaaggcg
ttctggaacgtcgtcaactgggaggacgtgcagaaccggttcgccaaggcgacgagttcg
gccagcggcatcatcgtcggctga

DBGET integrated database retrieval system