KEGG   Mycobacterium kansasii 824: LH54_14335Help
Entry
LH54_14335        CDS       T03653                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mki  Mycobacterium kansasii 824
Brite
Enzymes [BR:mki01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LH54_14335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIR28669
UniProt: X7YGX2
LinkDB All DBs
Position
3118285..3118908
Genome map
AA seq 207 aa AA seqDB search
MAEYALPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAIL
LNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIDEAFGSFDKFRAQFHAAATTV
QGSGWAALGWDTLGNKLLIFQVYDHQTNFPLGIIPLLLLDMWEHAFYLQYKNVKVDFAKA
FWNVVNWADVQARYEAATSKTQGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaatacgctttgcccgatctggattgggactacggggcgctggaaccacacatc
tcgggtcagatcaacgaacttcaccacagtaagcaccacgccacctacgtcaagggcgcc
aacgatgcggtcgccaaactcgaagaggcgcgcgccaaggaagaccactcggcgatcttg
ctgaacgagaagaacttggccttcaacctcgccggccacgtcaaccacacgatctggtgg
aagaacctttctcccaacggaggcgacaagccgaccggcgaactcgccgcggccatcgac
gaggcgttcgggtccttcgacaagtttcgtgcccaattccacgccgccgccaccacggtg
caggggtcgggctgggcggcgctgggctgggacactctcggcaacaagctgctgatattc
caggtctacgaccaccagacgaactttccactcggaatcattccgttactgctgctcgac
atgtgggaacacgctttctacctccagtacaagaatgtcaaggtcgacttcgccaaagca
ttctggaatgtcgtgaactgggccgacgtgcaggcgcgctacgaggcggccacttcgaaa
acgcagggcctgatcttcggctga

DBGET integrated database retrieval system