KEGG   Mycobacterium kansasii ATCC 12478: MKAN_20150Help
Entry
MKAN_20150        CDS       T02887                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00250  Alanine, aspartate and glutamate metabolism
mkn00410  beta-Alanine metabolism
mkn00430  Taurine and hypotaurine metabolism
mkn00650  Butanoate metabolism
mkn01100  Metabolic pathways
mkn01110  Biosynthesis of secondary metabolites
mkn01120  Microbial metabolism in diverse environments
mkn02024  Quorum sensing
Module
mkn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MKAN_20150
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MKAN_20150
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MKAN_20150
   00430 Taurine and hypotaurine metabolism
    MKAN_20150
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MKAN_20150
Enzymes [BR:mkn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MKAN_20150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGZ52354
UniProt: U5WT60
LinkDB All DBs
Position
4398004..4399386
Genome map
AA seq 460 aa AA seqDB search
MSRSHPSVPAHSIAPAYTGRMFTAPIPALRLPEESMDPEAAYQFIHDELMLDGSSRLNLA
TFVTTWMDPEAGQLMAETFDKNMIDKDEYPATAAIESRCVSMVADLFHAEGLRDDDPGSA
TGVSTIGSSEAVMLGGLAMKWRWRARTKDWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEKGRYVITPEQVIDAVDEDTIGVVAILGTTYTGELEPVAEICAALDGLAARGGVDVP
VHVDAASGGFVVPFLHPDLQWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEYLPEEL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQALSQTARWLGEQLEG
AEHCELISDGSAIPVVAFRLAGDRGYTEFDLSHELRTCGWQVPAYTMPDNATDISVLRIV
VREGLSADLARALHDDISTAVRTLDKVKPGGHYDAQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgcagccacccgtccgtgcccgcgcactcgattgctccggcctacaccgggcgg
atgttcaccgcccctatcccggcgctccggttgcccgaggaatcgatggatccggaagcc
gcctaccagttcatccacgacgagctcatgctcgacggcagttcgcggctgaacctggcc
acctttgtcaccacctggatggaccctgaggctgggcagctgatggccgagacgttcgac
aagaacatgatcgacaaagacgaatacccggcgaccgcggccatcgagtcccgctgtgta
tccatggtggccgaccttttccatgccgaggggctgcgcgacgacgacccgggcagcgcc
accggggtgtcgacgatcggctccagtgaggcggtaatgctgggtgggctggccatgaag
tggcgttggcgggcaaggaccaaggactggaagggtcgcacacccaacctggtgatgggc
tccaacgtgcaggtggtgtgggagaagttctgccggtacttcgacgtcgaaccccgttat
ctgccgatggagaaagggcgctacgtcattactcccgaacaggtcatcgatgccgtcgac
gaggacaccatcggtgtggtggcgattctgggcaccacctacaccggtgagctggagccg
gtcgccgagatctgcgcggcgctggacgggctggcagcccgcggcggggtggacgtcccc
gtgcacgtcgacgccgccagcggcggcttcgtggtgccgttcctgcatccggacctgcag
tgggacttccggctgccccgggtggtgtccatcaacgtcagcggccacaagtacgggctg
acctatcccggcgtcgggttcgtggtgtggcgcggccccgaatatctgcccgaggaactg
gtgttccgggtcaattacctgggcggggacatgccgacgttcacgctgaacttctctcgt
ccgggcaaccaggttgtcggccagtattacaacttcctgcggctgggccgcgagggttac
accaaggtcatgcaggcgctgtcgcagacggcgcggtggctcggcgagcagctggagggc
gccgagcattgcgagttgatctcggacggttcggcgattccggtggtcgccttccggctc
gccggggaccgcggttacaccgagttcgacctctcgcacgagttgcggacgtgcggatgg
caggtgccggcatacaccatgccggacaacgccaccgacatctccgtactgcgcattgtg
gtgcgggaaggactgtccgccgacctggcccgggcattgcatgacgacatctctaccgcg
gtgcgaaccctggacaaggtcaagcccggcgggcattacgacgcccagcacttcgcgcat
tag

DBGET integrated database retrieval system