KEGG   Mycobacterium kansasii ATCC 12478: MKAN_25875Help
Entry
MKAN_25875        CDS       T02887                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
mkn  Mycobacterium kansasii ATCC 12478
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5685981..5688767
Genome map
AA seq 928 aa AA seqDB search
MAGEERDVLALVRGLVAEVHPHAMPPSVTLDSTFDDLGIGSLELAELLLRVQGKYGVALP
SDLLASAETPRDLVVAVDRGHPVLAPERGVMVSLPTTEPGGLAPEAASTLNDVLDWHVGA
TPERMHIRLLDDSGGGTDLTYATLHREAAAVAAGLIAHDVMPGETVAIMLPTCRAYFTTF
AGVVLAGAVPVPVYPPARPSQLADHLRRTTGILTNAGATLLVTVPEAVTLGHLLRANVES
LRHVVVPETLMGTSEDASPSLPALPRPRSDDLALVQYTSGSTGQPKGVALAHRNLLANIR
AMGQAAGASGTDTFVSWLPLYHDMGLIGAWLGCMYFGVPLVVMSPQAFLIRPSRWLWAIH
ANRATMSAGPNFAYELCLAKVRDDEIAGLDLSSWRLAYNGAEPVSPATIERFADRFAAYG
FRPDAMTPVYGLAESSVGLAFPPLGRGPLIDRIRRDEFVRSGRAEPAWPGERDALRFVAC
GRPLPGHEIRIVDTAGTELGDRREGRIEFRGPSATAGYFNNPTPTRSLFHGDWLDTGDLG
YMADADLYVTGRVKDLIIRAGRNLHPAELEEAVGNLTGVRKGCVAVFASADRSGGAERLV
VVAETRLTEDAARAALRSEIASTTVDLLGVPPDDVVLAPPRTVLKTSSGKIRRAASRQLY
EAGRIGARPHAVWLELVRLRLRGAAPSLRRTGRAASAVAFAAYTWAVYLVLGLALVLLLL
LLPRERWRWWAVRRSIRLLARLTGTAITVHGLNHLPAQTCIAVANHPSWIDGIVLASVLP
PSFHFVVAEQLQQGLYGFALRRLGTQFVERHQREQGVADTDQLVGCARAGQSLVIFPEGR
LARAPGLRPFHIGAFVVAAEAGVPALPVAIRGTRSVMRPGHHFPRRGAIDVVIGMPIRPA
GRDWDAAVDVQRKAREAVLRMSGEPDVE
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgaggagcgcgacgtcctggcactggtgcgtggcctggtcgccgaagttcac
ccgcatgccatgcccccctcggtgacgctcgacagcactttcgacgacctcggtatcggc
agcctcgaactggccgaactgctgttgcgggtacagggcaaatacggggtggcgttgccg
tcagacctgctggccagtgccgagacaccgcgtgacctggtggtggcggtcgatcgcggc
catcccgtcctggcccctgagcgcggcgtcatggtgtctctgcccaccacggaaccaggc
gggctggcgcccgaagcggcgtcgaccctcaacgatgtcctcgactggcacgtcggcgcg
accccggagcgcatgcacatccggctgctcgacgattccggcggcggcacggacctgacg
tatgcgacgctgcaccgggaggcggccgccgtggcggccgggttgatcgcccacgacgtc
atgccgggcgagacggttgccatcatgttgcccacctgccgggcttacttcaccacgttc
gccggtgtggtgctcgccggcgcggtacccgttcccgtctacccgccggcccggccgtcc
cagttggccgatcatctgcgccgcaccaccggcatcctcaccaacgccggggccacgctg
ctggtcaccgtgcccgaggcggtgactctggggcatctgttgcgcgccaacgtcgaaagc
ctgcgtcacgtcgtcgtacccgaaaccctcatgggcacaagcgaagacgcctcgccgtcg
ctccccgcgctgccacggccgagatccgacgacctcgcgctggtgcagtacacctcgggc
agcaccggccagcccaaaggggtcgccctcgcgcaccgcaacctgcttgccaacatccgg
gccatgggccaagccgccggggcttcgggaacggatacgttcgtcagctggctgccgctg
taccacgacatgggtctgatcggcgcgtggctggggtgcatgtatttcggcgtcccgctg
gtggtgatgagtccccaggccttcctcatccgtccgtcccgatggctgtgggccatccac
gcaaaccgggcgaccatgtcggccggtcccaacttcgcctacgagctgtgcctggccaag
gtccgcgacgacgagatcgccgggctcgacctgagctcatggcgattggcctacaacggc
gccgagccggtgagccccgcgacgatagaacggttcgccgaccgcttcgccgcgtacggc
ttccggccagacgcgatgaccccggtgtacggtctggccgaatcctcggtgggcctggcc
ttcccgccgcttggccggggtccgctgatcgaccggatccgccgcgacgagttcgtgcgt
tccgggcgcgccgagccggcctggcccggcgagcgtgacgcactgcgcttcgtggcctgc
ggccggccgctgcccggccacgaaatccgcatcgtcgacaccgctggcaccgaactgggc
gatcgccgcgaaggacgcatcgagttccgtggtccgtcggcgaccgccggatatttcaac
aacccgacgcccacccgttcgctgttccacggcgactggctcgataccggcgacctgggc
tacatggccgacgccgacctctacgtcaccggccgggtcaaggatctgatcatccgggcc
ggccgtaacctgcatccggccgagctcgaagaggccgtcggcaacctcaccggggttcgc
aagggttgtgtggcggtgttcgcctccgccgatcggtcggggggcgccgaacgactcgtc
gtggtggccgagacgcggctgaccgaagacgccgcccgcgccgcgctgcgctccgaaatc
gcttccaccacagttgatttgcttggcgtaccgccggacgacgtggtgctggcgccgccg
cgcacggtgttgaagacctcgagcggcaagatccggcgggccgccagccggcaactgtac
gaggcgggacgaatcggcgcccggccacatgcggtgtggttggagttggtgcggctgcgg
ttgcgcggcgcggccccgtcgctgcgccgcaccggtcgcgcggcgtccgccgtcgcattc
gcggcgtacacctgggcggtgtacctggtcctggggctggcgctggtcttgttgctgttg
ctgttgccccgagagcgatggcggtggtgggcggttcggcgatcgatccgcctgctggct
cgccttaccggaacggccatcacggtgcatggcctcaatcacttgccggcccaaacctgc
atcgcggtggccaaccacccgagctggatcgacggaatcgtgctcgcctcggtgctgccg
ccgtcgttccacttcgtcgtcgccgagcagctgcagcaggggctgtacggatttgcgctg
cggcggctgggcacccagttcgtcgaacgtcaccagcgtgagcagggtgtggccgacacc
gaccagctggtcgggtgtgcgcgagcggggcagtcgctggtcatcttccccgaaggccgg
ctagcccgcgccccgggcttgcggcccttccacatcggcgcattcgtcgtcgcggccgag
gccggggtaccggcccttccggtcgccatccgggggacccggtcggtgatgaggccgggc
caccatttcccgcgtcgcggcgcgatcgacgtcgtcatcggcatgccgatccggcccgcg
ggccgggactgggatgcggcggtcgacgtgcaacgcaaggcccgcgaggcggtgctgcgg
atgtcgggcgagccggacgtcgaatga

DBGET integrated database retrieval system