KEGG   Methylomonas koyamae: MKLM6_4032Help
Entry
MKLM6_4032        CDS       T05118                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mko  Methylomonas koyamae
Pathway
mko00473  D-Alanine metabolism
mko00550  Peptidoglycan biosynthesis
mko01100  Metabolic pathways
mko01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mko00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MKLM6_4032
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MKLM6_4032
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MKLM6_4032
Enzymes [BR:mko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MKLM6_4032
Peptidoglycan biosynthesis and degradation proteins [BR:mko01011]
 Precursor biosynthesis
  Amino acid ligase
   MKLM6_4032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp RimK ATPgrasp_Ter ATPgrasp_ST ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ATG92207
LinkDB All DBs
Position
4571298..4572248
Genome map
AA seq 316 aa AA seqDB search
MKPLRITNPAEFGNVAVMMGGSAAEREISLNSGNAVYQALTAQGIAATALDVTGSPIDAL
AGRQFDRVFNIIHGRGGEDGVLQAILATLGLPYTGSGVLASALAMDKLRTKLCWQGAGLP
TPRWFLLHGEQDIDTCINALGFPVIVKPAQEGSSIGMSKAHNRDELAAALKTASQYRCDV
YAEQWIQGQEFTIGMLDGEALPAIRLETPHTFYDFDAKYRANTTQYHCPCGLSAEREREL
QALALRACQTVGVEGWGRVDAFIDDSGRMQLIEVNTVPGMTDHSLVPMAAKAVGVDFEEL
VWRILETSVAGTAGAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctttacggataaccaatcccgccgaattcggcaacgtcgccgtgatgatgggc
ggctcggctgcggagcgggaaatatcgttgaacagcggcaatgcggtttaccaagcatta
accgcccaaggcatcgccgccaccgcgctcgacgtgaccggcagtccaatcgacgcgctg
gcaggtcgccaattcgaccgagtgttcaacatcatccacggtcgcggcggcgaagacggc
gtgttgcaggcgatattggcgacgctgggtctgccttacaccggctccggcgtgctggct
tcggcgctggcgatggataagttgcgcaccaagctgtgctggcaaggcgccggcctgccg
actccgcgttggtttttgttgcatggcgaacaggatatcgacacctgcatcaatgcgctg
ggttttccggtcatcgtcaagccggctcaggaaggctccagcatcggcatgagcaaagcc
cataaccgcgacgagttggccgccgcgttgaaaaccgccagccagtaccgctgcgacgtt
tatgccgagcaatggatccagggccaggaatttacgataggcatgctggacggcgaagcg
ctgccggcgatccggctggaaacgccgcataccttttacgacttcgacgccaaataccgc
gccaacaccacgcaataccattgcccgtgcggtttgagcgccgaacgcgagcgcgaattg
caggccttggctctgagagcctgccagaccgtcggcgtcgaaggctggggccgggtcgat
gcctttatcgacgacagcggccgcatgcaattgatcgaagtcaataccgtacccggcatg
accgaccatagtctggtaccaatggcggctaaagcggttggcgtcgacttcgaggaattg
gtgtggcggatattggagaccagcgtggcgggaacggcgggtgcggcttag

DBGET integrated database retrieval system