KEGG   Mycobacterium kansasii 662: LG40_13460Help
Entry
LG40_13460        CDS       T03652                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mks  Mycobacterium kansasii 662
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2944285..2945322)
Genome map
AA seq 345 aa AA seqDB search
MAAAAEELDVDGIRVRVTNPDRVYFPQLGSGGTKRRLVEYYLAVGRGPMLAALRDRPTHL
QRFPDGIDGEEIYQKRVPQHHPDYLQTCRVTFPSGRTADALKVTHPAAIVWAAQMGTVTL
HPWQVRCPDTEHPDELRIDLDPQPGTGFAQARAVAVDVLRPLLDELGLVGYPKTSGGRGV
HVFLRIATDWDFIQVRRAGIALARELERRAPGAVTTSWWKEQRGARIFVDFNQNARDRTM
ASAYSVRPTPIATVSTPLTWDELAGADPDDYTIATVPDLVAGREDPWAGMDDVAQSIAPL
IDLAAADDERGLGDLPYPPNYPKMPGEPKRVQPSRDTDLKRDTKG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcagcagaagaactcgacgtcgacggcatccgggtgcgggtgaccaacccg
gacagggtgtacttcccgcagctcgggtccggcggcaccaagcgacggctggtcgagtac
tacctcgccgtgggccggggcccgatgctggctgcgcttcgcgaccggcccacgcatctg
cagcgcttccccgacggcatcgacggcgaggagatctatcaaaagcgggtgccccagcat
catcccgactacctgcagacctgccgggtgacgttcccgtcgggacgcaccgccgatgcg
ctgaaagtcacccatcccgcggcgatcgtgtgggccgcgcagatgggtaccgtgacgctg
cacccatggcaggtgcgctgccccgacaccgagcatcccgacgaattgcgcatcgatctg
gatccgcagcccggcaccggttttgcgcaggcgcgggcagtcgccgtcgacgtgttgcgg
ccgctgctcgacgaactcgggttggtcggctacccgaagacttccgggggacgcggggtg
cacgtgtttctccggatcgccaccgactgggacttcatccaggtgcgccgggcgggcatc
gcgctggcccgcgaattggagcggcgcgcacccggcgcggtgaccacgtcctggtggaaa
gaacagcggggcgcgcgaatcttcgtcgacttcaaccagaatgctcgcgaccgcaccatg
gcgtcagcgtattcggtgcgcccaactccgattgccaccgtttcgacaccgttgacgtgg
gacgagctggccggtgcggatcccgacgactacaccatcgccacggtgcccgatctggtg
gcgggtcgcgaggacccgtgggccggcatggacgatgtggctcaatcgattgcgccgttg
atcgacctggccgccgctgacgacgagcgtgggctgggtgacctgccctatccgccgaac
tatccgaaaatgccgggcgagcccaaacgggtgcagccgagccgggatacggatctgaaa
agggacaccaaggggtga

DBGET integrated database retrieval system