KEGG   Mycobacterium kansasii 662: LG40_19970Help
Entry
LG40_19970        CDS       T03652                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mks  Mycobacterium kansasii 662
Pathway
mks00250  Alanine, aspartate and glutamate metabolism
mks00410  beta-Alanine metabolism
mks00430  Taurine and hypotaurine metabolism
mks00650  Butanoate metabolism
mks01100  Metabolic pathways
mks01110  Biosynthesis of secondary metabolites
mks01120  Microbial metabolism in diverse environments
mks02024  Quorum sensing
Module
mks_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mks00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LG40_19970
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LG40_19970
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LG40_19970
   00430 Taurine and hypotaurine metabolism
    LG40_19970
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LG40_19970
Enzymes [BR:mks01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LG40_19970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIR20123
UniProt: X7ZRX9
LinkDB All DBs
Position
4355059..4356441
Genome map
AA seq 460 aa AA seqDB search
MSRSHPSVPAHSIAPAYTGRMFTAPIPALRLPEESMDPEAAYQFIHDELMLDGSSRLNLA
TFVTTWMDPEAGQLMAETFDKNMIDKDEYPATAAIESRCVSMVADLFHAEGLRDDDPGSA
TGVSTIGSSEAVMLGGLAMKWRWRARTKDWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEKGRYVITPEQVIDAVDEDTIGVVAILGTTYTGELEPVAEICAALDGLAARGGVDVP
VHVDAASGGFVVPFLHPDLQWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEYLPEEL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQALSQTARWLGEQLEG
AEHCELISDGSAIPVVAFRLAGDRGYTEFDLSHELRTCGWQVPAYTMPDNATDISVLRIV
VREGLSADLARALHDDISTAVRTLDKVKPGGHYDAQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgcagccacccgtccgtgcccgcgcactcgattgctccggcctacaccgggcgg
atgttcaccgcccctatcccggcgctccggttgcccgaggaatcgatggatccggaagcc
gcctaccagttcatccacgacgagctcatgctcgacggcagttcgcggctgaacctggcc
acctttgtcaccacctggatggaccctgaggctgggcagctgatggccgagacgttcgac
aagaacatgatcgacaaagacgaatacccggcgaccgcggccatcgagtcccgctgtgta
tccatggtggccgaccttttccatgccgaggggctgcgcgacgacgacccgggcagcgcc
accggggtgtcgacgatcggctccagtgaggcggtaatgctgggtgggctggccatgaag
tggcgttggcgggcaaggaccaaggactggaagggtcgcacacccaacctggtgatgggc
tccaacgtgcaggtggtgtgggagaagttctgccggtacttcgacgtcgaaccccgttat
ctgccgatggagaaagggcgctacgtcattactcccgaacaggtcatcgatgccgtcgac
gaggacaccatcggtgtggtggcgattctgggcaccacctacaccggtgagctggagccg
gtcgccgagatctgcgcggcgctggacgggctggcagcccgcggcggggtggacgtcccc
gtgcacgtcgacgccgccagcggcggcttcgtggtgccgttcctgcatccggacctgcag
tgggacttccggctgccccgggtggtgtccatcaacgtcagcggccacaagtacgggctg
acctatcccggcgtcgggttcgtggtgtggcgcggccccgaatatctgcccgaggaactg
gtgttccgggtcaattacctgggcggggacatgccgacgttcacgctgaacttctctcgt
ccgggcaaccaggttgtcggccagtattacaacttcctgcggctgggccgcgagggttac
accaaggtcatgcaggcgctgtcgcagacggcgcggtggctcggcgagcagctggagggc
gccgagcattgcgagttgatctcggacggttcggcgattccggtggtcgccttccggctc
gccggggaccgcggttacaccgagttcgacctctcgcacgagttgcggacgtgcggatgg
caggtgccggcatacaccatgccggacaacgccaccgacatctccgtactgcgcattgtg
gtgcgggaaggactgtccgccgacctggcccgggcattgcatgacgacatctctaccgcg
gtgcgaaccctggacaaggtcaagcccggcgggcattacgacgcccagcacttcgcgcat
tag

DBGET integrated database retrieval system