KEGG   Mycobacterium leprae TN: ML0578Help
Entry
ML0578            CDS       T00047                                 

Gene name
ppc
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00620  Pyruvate metabolism
mle00680  Methane metabolism
mle01100  Metabolic pathways
mle01120  Microbial metabolism in diverse environments
mle01200  Carbon metabolism
Module
mle_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ML0578 (ppc)
  Energy metabolism
   00680 Methane metabolism
    ML0578 (ppc)
Enzymes [BR:mle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ML0578 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 909360
NCBI-ProteinID: NP_301490
Pasteur: ML0578
UniProt: P46710
LinkDB All DBs
Position
700214..703018
Genome map
AA seq 934 aa AA seqDB search
MVEFSDAILEPIGAVQRTRVGREATEPMRADIRLLGTILGDTLREQNGDEVFDLVERVRV
ESFRVRRSEIDRADMARMFSGLDIHLAIPIIRAFSHFALLANVAEDIHRERRRHIHLDAG
EPLRDSSLAATYAKLDLAKLDSATVADALTGAVVSPVITAHPTETRRRTVFVTQRRITEL
MRLHAEGHTETADGRSIERELRRQILTLWQTALIRLARLQISDEIDVGLRYYSAALFHVI
PQVNSEVRNALRARWPDAELLSGPILQPGSWIGGDRDGNPNVTADVVRRATGSAAYTVVA
HYLAELTHLEQELSMSARLITVTPELATLAASCQDAACADEPYRRALRVIRGRLSSTAAH
ILDQQPPNQLGLGLPPYSTPAELCADLDTIEASLCTHGAALLADDRLALLREGVGVFGFH
LCGLDMRQNSDVHEEVVAELLAWAGMHQDYSSLPEDQRVKLLVAELGNRRPLVGDRAQLS
DLARGELAVLAAAAHAVELYGSAAVPNYIISMCQSVSDVLEVAILLKETGLLDASGSQPY
CPVGISPLFETIDDLHNGAAILHAMLELPLYRTLVAARGNWQEVMLGYSDSNKDGGYLAA
NWAVYRAELALVDVARKTGIRLRLFHGRGGTVGRGGGPSYQAILAQPPGAVNGSLRLTEQ
GEVIAAKYAEPQIARRNLESLVAATLESTLLDVEGLGDAAESAYAILDEVAGLARRSYAE
LVNTPGFVDYFQASTPVSEIGSLNIGNRPTSRKPTTSIADLRAIPWVLAWSQSRVMLPGW
YGTGSAFQQWVAAGPESESQRVEMLHDLYQRWPFFRSVLSNMAQVLAKSDLGLAARYAEL
VVDEALRRRVFDKIADEHRRTIAIHKLITGHDDLLADNPALARSVFNRFPYLEPLNHLQV
ELLRRYRSGHDDEMVQRGILLTMNGLASALRNSG
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atggttgagttttccgatgctatactggaaccgatcggtgctgtccagcggactcgagtc
ggtcgcgaggcgactgaacctatgcgggccgacatcaggctattgggtaccattcttggt
gatactctgcgtgagcagaacggtgatgaggtattcgatctcgtcgaacgagtccgggtc
gagtcgttccgggtgcggcgttctgagattgatcgggccgatatggcgcgtatgttctct
ggtctcgacattcacctggccatcccgatcatccgggcgtttagccatttcgcattgttg
gccaacgttgccgaggacatccaccgggagcgtcggcgccatattcacctcgacgccggc
gagccactgcgggatagcagtttagcggccacttacgcgaaacttgatctggcaaaacta
gattcggccaccgtggcagatgcccttactggtgcagtggtctcgccggtgattactgcg
catcccaccgagacccgtcggcgtaccgtatttgttacccaacgccggattaccgagttg
atgcggctgcacgcggagggacacaccgaaaccgccgatggccgcagcattgagcgtgaa
ttgcgccgtcaaattctcacgctgtggcagacggcattgattcggttggcgcgattgcag
atctccgacgagatcgacgtagggctgcgatattactctgccgcgcttttccatgtgatt
ccgcaggtgaattccgaggtgcgcaacgcgttgcgtgcccggtggcccgacgccgagctg
ctgtccggccctatactgcaacccggatcgtggatcggtggtgaccgggacggaaacccg
aacgtgactgccgacgtggtgcggcgagcgaccggcagcgctgcctacaccgtggtggcg
cactatttggctgaactcacccacctcgagcaggagctgtcgatgtcggcgcgactgata
accgtcacccctgagctggccacgctggccgctagctgtcaggacgcggcctgtgccgac
gagccgtaccggcgggcattgcgggtgatccgcggtcgattgtcctcgactgccgcccac
atcctggatcagcagccacccaaccagcttggtctgggtttgccaccgtattcgacgcca
gccgaactatgtgccgatctggacaccatcgaagcctccctgtgcacgcacggcgccgcg
ttgttagccgacgatcggttggcgctgttgcgagaaggtgttggagtctttgggtttcac
ttgtgcggtctggatatgcggcaaaattccgacgtgcacgaagaggtggtcgctgagctg
ttggcgtgggccgggatgcaccaggactacagttcgttgcccgaagatcaaagagtcaag
ctgctggtggccgaactcggtaaccgccgcccgttggtcggggatcgtgcgcaattatcc
gatttggcgcgcggcgagctggccgttcttgcggccgctgcccacgccgttgagctctac
ggatcggccgcggtgcccaactacatcatctcgatgtgtcagtctgtgtcggatgtcctg
gaggtcgcgatcctcttgaaggagactggcctgttagacgcctccgggtcgcagccgtac
tgtccggtgggcatctcgccgctgttcgagacgatcgacgatctgcacaacggggcggcc
attctgcacgcgatgctggaacttccgctatatcgaacgctggtggctgctcgcggtaac
tggcaggaagtgatgctcggctactccgattccaacaaagatggcggctatctggccgcc
aactgggcggtttaccgcgccgagctcgctctggtagacgtggcccgcaaaaccggaatc
cgtttgcgacttttccatggtcgtggcggcactgtcggacgtggcggcggtcctagctat
caagctattctggcgcaacccccgggggcggtaaacggctcgttgcgtctcaccgagcaa
ggcgaggtcatagccgccaaatacgccgaaccgcaaatagcacgacgaaacctagagagt
ttggtggccgcgaccctagaatcaactctcttggatgttgaaggcttaggcgatgcggct
gaatctgcttacgccatactcgatgaagtagccggcctcgcgcggcgatcctacgctgaa
ttagtcaacacaccgggtttcgttgactatttccaagcttccacgccggtcagcgagatc
ggatcgttgaacattggcaaccgaccgacatcacgtaagcctaccacgtcgatcgcggat
cttcgtgctattccgtgggtactggcatggagccaatcgcgagtcatgctcccaggttgg
tatggcaccggatcggcgtttcagcagtgggttgcggctggacccgaaagtgaatcacag
cgggtagaaatgctgcatgacctctatcagcgttggccgttctttcgaagtgtgctgtcg
aacatggcgcaggtactggccaaaagtgatctgggcctggcggcccgctatgctgagctg
gtggtcgacgaagccttgcggcgcagagtgtttgacaagatcgccgacgagcatcggcga
accattgccatccacaagctcattacgggtcatgacgatctgcttgctgacaacccggct
ctggcgcgttcggtgttcaaccgcttcccgtatctggagccgttaaaccaccttcaggtg
gagctattgcgccgctaccgctcgggtcacgacgacgaaatggtgcaacgcggcatcctt
ttgacaatgaacggattggccagcgcgctacgtaacagcggctaa

DBGET integrated database retrieval system