KEGG   Mycobacterium liflandii: MULP_01313Help
Entry
MULP_01313        CDS       T02444                                 

Gene name
fadD29_1
Definition
(GenBank) fatty-acid-CoA ligase FadD29_1
Organism
mli  Mycobacterium liflandii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1405331..1407205
Genome map
AA seq 624 aa AA seqDB search
MISYEGLHARAAHLAAVLQARGAQGERVILASRDNIEMTVGLVACLYSGAVAVPVPVPNM
NKSGPALLRLQAIARDAQARVFLTDLPSVDSQSNVRTLPDGLSELTWLNTDDASADRADW
QPPRYAPESAALLQYTSGSTGQPKGVMLTQANLLSNAHQIERHWEQDQNELLVSWLPQYH
DFGLIFMALQALYLGATLVSMPPSAFVQDPLRWLRCLTQYRGTNSGAPNFAFDLCVEQST
PAQREGLDLRSVKALNCGAEPVRAETMRRFLAAFAPFGLRPDALRPGYGLAEATVFVTGW
RGPAVKTLTLDQRQLNEGRVVECDVAATPLTEVVCCGPAGPEVELAIVSTQTQQPCAADE
VGEIWVRGPNISRGYFNGAGASQDCFGNVAGQGQYLRTGDLGFVQDGDLYVTGRLKDLVI
VRGVNHYPQDIEFSVEQSHPAIRPGYCAAFTLEVDGEERLGVAAEIAADDPAQDTLESAM
DSILQAIISHHEVVPYRLVLLARGAIPKTSSGKIQRQLCKQLLLIDQLPILGDRVSTATI
SPTPQQPDGGARSPKYRAMEQYLLELLNLSPEELESGNNLAAYGFDSIDGAALAKKIKAD
WDIEVPMEILPLLTIRDLVDTLAN
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagctacgaagggctgcacgcgcgcgccgcccatctggcggcggtgctgcaggcg
cggggggcgcaaggcgagcgggtgatcctggccagtcgcgacaacatcgagatgacagtg
gggctggtcgcctgcctgtacagcggcgcggtagcggtgccggtgccggttccgaatatg
aacaagtcggggccggcattgctgcgactgcaggccattgcgcgagatgcacaggcgcgc
gtcttcttgaccgacctgccgtcggtggactctcaatcaaacgtgcgcactctgcccgac
gggctttcggagctgacctggctgaacaccgacgacgccagcgccgaccgggccgactgg
caacccccgcggtatgcgcccgagagcgcggcgctgctgcagtacacctctggctcgacc
gggcagcccaaaggggtgatgctcacccaggccaacttgctgtccaatgcccaccagatc
gagcggcattgggaacaagaccaaaatgagttgcttgtctcctggctccctcagtatcac
gactttgggctgatcttcatggcgctacaagcgctctatctgggggccacgttggtttcg
atgcccccctccgcctttgtgcaggacccgctgcgttggcttcgctgcctcacccagtac
cgcggtaccaacagcggcgcgcccaacttcgccttcgatctctgcgtggagcaaagcacg
ccggctcagcgcgaggggctggacctgcgtagcgtcaaggcgttgaactgcggcgctgag
ccggtgcgggcggagacgatgcgccgtttcctggccgcgtttgccccgttcgggttgcgg
ccggatgcccttcggcccggttacggtctggccgaagccacggtgttcgtgaccggctgg
cgcgggcccgcagtcaagacattgacgctggaccagcgccagctcaacgagggccgggtc
gtggaatgtgacgttgccgcaacgcctttgacggaggtcgtttgctgcggtccggcgggc
cccgaagtggagctggccattgtctcgacgcagacccaacagccatgcgctgccgacgaa
gtgggcgagatctgggtgcgggggcccaatatcagccggggctacttcaacggtgccggc
gcaagccaagactgcttcggcaacgtcgcgggccaaggacagtacttgcgtacgggcgac
ctgggttttgtgcaagatggcgacctgtacgtgacgggtcggctgaaggacctggtgatc
gtgcgcggagtcaaccactacccgcaagacatcgaattctcggtcgagcaatcccacccc
gcgatccggcccggatactgcgccgccttcacgctggaggtcgatggtgaagagcgactg
ggcgtcgccgcggaaatcgcggcagacgatccggcgcaagacaccctggaaagtgcgatg
gactcgattcttcaggccattatcagccaccacgaggtggtgccctaccggctggttctc
ttggcccgcggcgccattcccaagacctccagtggcaagatccagcggcaactgtgcaaa
cagctgctgttgatcgatcagctgccgattctcggcgaccgtgtcagtaccgcgacgata
tcgccgacgccgcagcaacctgatggtggcgcgcgatcgccaaagtatcgcgcgatggag
cagtacctcctcgagctgttgaatctgagtcccgaagaactggagagcggcaacaatcta
gccgcctatggttttgattccatcgatggcgcagctttggctaagaaaatcaaggccgac
tgggacattgaagtcccgatggaaatattgccgctcctgaccatcagagatctcgtggat
acgctcgccaactag

DBGET integrated database retrieval system