KEGG   Mycobacterium liflandii: MULP_02690Help
Entry
MULP_02690        CDS       T02444                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase, Ppc
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mli  Mycobacterium liflandii
Pathway
mli00620  Pyruvate metabolism
mli00680  Methane metabolism
mli01100  Metabolic pathways
mli01120  Microbial metabolism in diverse environments
mli01200  Carbon metabolism
Module
mli_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MULP_02690 (ppc)
  Energy metabolism
   00680 Methane metabolism
    MULP_02690 (ppc)
Enzymes [BR:mli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MULP_02690 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AGC62489
UniProt: L7VAR8
LinkDB All DBs
Position
2878600..2881407
Genome map
AA seq 935 aa AA seqDB search
MVEVSDTALEPIGDVHRTRIGREATEPMRADIRLLGAILGDTVREQNGDEVFELVERARV
EAFRVRHSEIDRAEMARMFEGIDIHHAIPIIRAFSHFALLANVAEDIHRERRRSIHVAAG
EPPQDSSLAATYMKLDAAQLDSATIAEALKGALVSPVITAHPTETRRRTIFETQHRITQL
MRLHAEGHTETDDGRGIEVELRRQVLRLWQTALIRLFRLQISDEIEVGLRYYPAALFEVI
PQVNAEVRDALRARWPDADLLSEPILRPGSWIGGDRDGNPNVTAEVVRLATGSAAFTALA
HYLAELTALAQELSMSARLITVTPELATLADACPAGARPDEPYRRALQVVRGRLSATAAE
ILDQQPQHTLELGLPPYATAAELRADLDTIDASLHNHGAGLLADDRLARLREAVRVFGFH
LSGLDMRQNSDVHEQVVGELLAWAGVHPDYTSLAEAERVELLAAELSTRRPLIRDGAQLS
DLARSELGVLAAAAHAVWTFGPAAVPNYIISMCRSVSDMLEAAVLLKEVGLLDASESEPY
CPVGISPLFETIEDLHNGAAILQAMLDLPLYRALVTARGGCQEVMLGYSDSNKDGGYLAA
NWAVYRAELALVETARKTGIRLRLFHGRGGTVGRGGGPSYQAILAQPPGAVSGSLRLTEQ
GEVIAAKYAEPQMARRNLESLLAATLESTLLDVEGLGNTAAPAYAVLDEVAALAQRAYAE
LVHETPGFVEYFKASTPVSEIGALNIGSRPTSRKPTASIADLRAIPWVLAWSQSRVMLPG
WYGTGSAFEQWLAAGPESEADRLQVLHDLYQRWPFFRSVLSNMAQVMAKSDLELAARYSE
LVADETLRRRVFDKIADEHHRTIAMYKRITGQDDLLADNPALARSVFNRFPYLEPLNHLQ
VELLRRYRSGEDDESVLRGILLTMNGLASALRNSG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtgtccgataccgcactcgagcccattggcgacgtccaccggacccggatt
ggccgcgaggctaccgaaccaatgcgagccgacatcagactgctgggcgccatcctcggg
gataccgtccgtgagcaaaacggtgacgaggtcttcgagttggtggagcgggcgcgggtg
gaggcctttcgggtgcggcactccgagatcgaccgcgccgagatggcgcgcatgttcgag
ggcatcgacatccaccacgccatcccgatcatccgtgcgttcagtcacttcgcgttgctg
gccaatgtggccgaagacatccaccgggagcgccgtcgcagcattcacgtcgccgccggt
gagccgccgcaggacagcagtctggccgccacgtacatgaaacttgacgcggcccagttg
gattcggcaaccatcgccgaagcgctgaagggcgcactagtgtctccggtcatcaccgcc
catccgaccgagacccggcggcgcaccattttcgagacccagcaccggatcacccagttg
atgcggttgcacgcggaaggccacaccgaaaccgacgacgggcgcggcatcgaagtcgaa
ttgcgtcggcaggtcttgaggttgtggcagaccgcgctgatccggctgtttcggttacag
atctccgacgagatcgaggtcgggttgcggtactacccggcggcgctcttcgaggtgatt
ccgcaggtgaatgccgaggtgcgggatgcgttgcgagcccgctggcccgatgccgacctg
ctttccgaacccattttgcggccgggctcgtggatcggcggggaccgggacggaaacccg
aacgtcaccgccgaggtggttcggctggccaccggcagtgccgctttcaccgcgctggcg
cactacctggccgaactgacggcacttgcgcaggagctttcgatgtcggcgcgactgatc
accgtcacccccgaattggccacgctggccgatgcctgtccggcgggtgcccgccccgac
gagccgtaccggcgcgccttgcaggtcgtgcgcggccggctcagcgccaccgcggccgaa
atcctggaccagcaaccgcagcacacgctggagttgggcttgccgccatatgccaccgcg
gccgaactgcgggccgatctggacaccatcgatgcctcactgcataaccacggcgccggg
ttgttggccgacgaccggctggcccggctgcgtgaagcggtgcgggtcttcggatttcat
ctctccggcctggacatgcgacagaactccgacgtccacgagcaggtggtcggagagctg
ctcgcgtgggcgggcgtgcacccggactacacctcgctggccgaagcggagcgggtcgag
ctgttggcggccgaactgagcacccgccggccgctgatccgcgatggcgcgcagctttcc
gatttggctcgcagcgaactgggcgttctggcggccgccgcccacgccgtctggaccttt
ggtcccgccgcggtgcccaactacatcatctcgatgtgccggtcggtatcggacatgctg
gaagccgcggtcctgctcaaagaggtcggcctactggacgcttccgagtcggaaccctat
tgcccggtgggtatctcgccgctgttcgagacgatcgaggacctgcacaacggggcggcc
attctgcaagcgatgttggatcttccgctctatcgcgctttggtgacggcccggggtggt
tgccaggaggtgatgctcggctactcggactcgaacaaggacggcgggtatctggccgcc
aactgggcggtgtatcgagccgaactcgcgctggtggagacggcgcgcaagaccggaatc
cggctgcggctcttccatggccgtggcggcacggtcggccgcggtggcggacccagctac
caggccatcctggcgcagccgccgggtgcggtaagcggatcgttgcggctcaccgaacag
ggtgaagtgatcgccgccaagtacgccgaaccgcagatggcccgacgcaatctggagagc
ctgctggccgccaccctggagtcgacgctgctggacgtcgaggggttgggcaatacggcg
gcgccggcctatgcggtgctcgacgaggtggcggcattggcgcaacgtgcctacgccgaa
ttggtgcacgagacaccgggtttcgtcgagtacttcaaggcttccaccccagtcagcgaa
atcggggcgctgaacatcggcagccggccgacctcgcgcaaacccaccgcttccatcgcc
gacctgcgggccatcccgtgggtgctggcttggagccagtcgcgggtgatgcttcccggc
tggtacggcactggctcggcattcgagcaatggctagcggcgggtcccgaaagtgaggcc
gaccggctgcaggtgctgcacgacctgtatcagcggtggccgtttttccgcagcgtgctg
tccaacatggcgcaggtgatggccaagagcgacctggaactggcggcccgctactccgaa
ctggtggccgacgaaacgctgcggcgccgggtgttcgacaaaatcgccgacgagcaccac
cgcaccatcgccatgtacaagcgaatcaccggacaagacgacctacttgccgacaacccg
gccctggcgcgctcggtgttcaaccggttcccctacttggaaccgctcaaccaccttcaa
gtcgaactgctccgccgttaccgcagcggtgaggacgacgaatccgtgctgcgcggcatt
ctgctgacgatgaacgggctggccagcgcgctaagaaacagcggctga

DBGET integrated database retrieval system