KEGG   Mesorhizobium loti NZP2037: A9174_00215Help
Entry
A9174_00215       CDS       T04711                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mln00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A9174_00215
   00650 Butanoate metabolism
    A9174_00215
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9174_00215
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A9174_00215
Enzymes [BR:mln01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A9174_00215
Amino acid related enzymes [BR:mln01007]
 Aminotransferase (transaminase)
  Class III
   A9174_00215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(44582..45859)
Genome map
AA seq 425 aa AA seqDB search
MKNSAISERKNQSISRGVGMTTQIYADRAENSEIWDVEGRRYIDFSSGIAVVNTGHRHPR
VIEAVKAQLDRFTHTCHQVVPYESYVRLAERLNAMLPGKFEKKTIFVTTGAEAVENAIKI
ARNATGRPAVIAFAGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVYHAPFPVPLHGVSVA
DSLAALDRLFKADVDPARVAAIIVEPVQGEGGFYEAPREFLTALRKLCDQHGMLLIADEV
QTGFARTGKMFAMDHHEVAADITTMAKSLAGGFPLSAVTGRAEIMDAPGPGGLGGTYGGS
PIGVAAAHAVLDVIEDEKLCDRANTLGARLKQRLQSIRDDVPEIVDIRGLGFMNAVEFND
VKKGLPSAEIANAIRLKALDKGLILLTCGVYGNVIRFLAPITIQDEVMNEALDILESSIR
EVCAA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattcagccatttccgaacgcaaaaaccagtcgatctcgcgcggcgtcggcatg
accacgcaaatctatgccgaccgggccgaaaattcggaaatctgggatgtcgaaggccgt
cgctacatcgacttttcctcgggcatcgccgtcgtcaacaccggccaccgccaccccagg
gtgatcgaagcggtcaaggcgcagctcgaccgtttcacccacacctgccaccaggtcgtg
ccctatgagagctacgtcaggctggccgaacggctgaatgccatgctgcccggcaagttc
gagaagaagacgatcttcgtcaccaccggcgccgaggcggtcgagaacgccatcaagatc
gcccgcaatgccaccggacgcccggccgtcatcgccttcgccggcggcttccatggccgc
accttcatgggcatggcgctgaccggcaaggtcgtgccctacaaggtcggcttcggcgcc
atgccgggcgacgtctatcacgcgccgttcccggtgccgctgcatggtgtgtcggttgcc
gattcgctggccgcactcgaccggttgttcaaggccgatgtcgatccggcccgcgtcgcc
gccatcattgtcgagccggttcagggcgagggcggcttctacgaggcgccgcgcgaattc
ttgaccgcgctgcgcaagctctgcgaccagcacggcatgcttttgatcgccgacgaggtg
cagaccggctttgcccgcaccggcaagatgttcgcgatggatcaccatgaagtcgcggcc
gacatcaccaccatggccaagagcctggccggcggcttcccgctgtcggccgtcaccggc
cgcgccgaaatcatggatgcgcccggccccggcggcctcggcggcacctatggcggcagc
ccgatcggggttgccgcagcacacgcggttctcgacgtgatcgaggacgaaaagctttgc
gaccgcgccaacaccctgggcgcgcggctgaagcagcgcctgcagtcgatccgcgacgac
gtgcccgagatcgtcgatatcaggggcctcggcttcatgaacgcggtcgagttcaacgac
gtcaagaagggcctgccgtcggccgagatcgccaacgccatccggctgaaagcgctcgac
aagggcctgatcctgctgacctgcggcgtctacggcaacgtcatccgcttccttgcgcca
atcaccatccaggacgaggtcatgaacgaggcgctcgacattctggaaagctcgatccgc
gaagtctgcgccgcctga

DBGET integrated database retrieval system