KEGG   Mesorhizobium loti NZP2037: A9174_21290Help
Entry
A9174_21290       CDS       T04711                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
mln  Mesorhizobium loti NZP2037
Pathway
mln00340  Histidine metabolism
mln01100  Metabolic pathways
mln01110  Biosynthesis of secondary metabolites
mln01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mln00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    A9174_21290
Enzymes [BR:mln01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     A9174_21290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: ANN61612
LinkDB All DBs
Position
complement(4424352..4424810)
Genome map
AA seq 152 aa AA seqDB search
MSALEFPRTPSDKRALEEGAVFSPRFDAAGLVTVVVTDAEDGMLLMVAHMNAQALALTLE
TGIAHYWSRSRNALWKKGETSGNFQHVVEMRTDCDQDALWLRVKVLGHDATCHTGRRSCF
YRTVGLVDGKGTLVDDGSKPLFDAEVTYRKPV
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcacttgaatttcccagaactccatcagacaagagggccttggaggaaggcgcg
gtgttctcgccgcgcttcgacgccgccggccttgtcaccgtcgtcgtcaccgatgccgaa
gacggcatgctgctgatggtcgcgcatatgaatgcgcaggccttggcgctgacactggaa
accggcatcgcccactactggtcgcgctcgcgcaacgcgctttggaagaagggcgaaacc
tccggcaatttccaacatgtcgtcgagatgcgcaccgactgcgatcaggatgcattgtgg
ctgcgcgtcaaagtgttgggccacgacgcaacctgtcacaccggccggcgttcatgcttt
tatcggacggtggggcttgtcgacggcaagggaacgcttgttgacgacggcagcaagccg
ctgttcgatgcggaagtcacgtatcggaagcctgtgtga

DBGET integrated database retrieval system