KEGG   Mesorhizobium loti NZP2037: A9174_27855Help
Entry
A9174_27855       CDS       T04711                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mln  Mesorhizobium loti NZP2037
Brite
Enzymes [BR:mln01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A9174_27855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANN60146
LinkDB All DBs
Position
complement(5733414..5734013)
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGMGDLSVEEVVKQS
FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAFDSDLGGYDKFKADFVAAGT
TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDHVLELYEKAK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgcccgctctgccctacgactatgaggccttgcagccttacatgtcg
aaagagacgctggaatatcaccacgacaagcatcacaaggcctatgtcgacaatggcaac
aagctggctgccgaggccggaatgggtgatctgtcggtcgaagaggtggtcaagcagtcg
ttcggcaagaatgcaggtctcttcaacaatgccgcgcagcactacaatcacatccatttc
tggaagtggatgaagaagggcggcggcggcaacaagctgccgggcgcgctgcagaaggcc
ttcgacagcgatctcggcggctacgacaagttcaaggctgattttgttgccgccggcacg
acgcagttcggttcgggctgggcctgggtttcggtcaaggacggcaagctggcgatctcg
aagaccccgaacggcgaaaacccactcgttcatggcgcctcgccgatcctcggtgtcgac
gtctgggaacactcctattacatcgactaccgcaacgcccgcccgaaatatctcgaggcc
ttcgtcgacagcctgatcaactgggatcatgtgctggaactttacgaaaaggcgaagtga

DBGET integrated database retrieval system