KEGG   Melampsora larici-populina: MELLADRAFT_118439Help
Entry
MELLADRAFT_118439 CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
mlr  Melampsora larici-populina
Brite
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MELLADRAFT_118439
Chromosome [BR:mlr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     MELLADRAFT_118439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 659 aa AA seqDB search
MKSITNPSPSSSSSEAEEVEPILFIIQDDCYKHLYKRSHQPMEVFERPQRLRYVNLGLSS
TLAWISNQNQLQIYPSINNQHPSLTNLIISNHFIVSKSSNRINLNDTSFNQIHSSSKGLV
SSSPSTTTTSTSSSQSLSSKVDQESSYLDQLIKLCRHTSHQHQLGLSEVPDHLPQGDLYL
SAGTEFAVLGAIGACYDALDSVLKPNQTSTSNLQKPSTKAFVNIRPPGHHCTDTEPMGFC
WANNVLVSCMYAHLNYAIDRICIVDIDLHHGNGSQQIVWEINQRSQESSNSSNSKRTLKI
SYSSLHDINSYPCEDGQLDKIREASLNLCVGNSIQQFIQNLHLEVWKDEIDFFDRLYPKI
WNSFQDHMIMFFKITDAIEENSLIFVSAGFDACELETDSMSRYGMKLPTSFYHRFSKDLS
QFSQTYTKGRVISFLEGGYSDQTLLGSSLSYLLGLIDYPIDFEKVPWELDRIEKILKLVI
KKPNQEIEDEIVLIEKIREIFNYLDGFEKSKIEMRSEIKKMGKNKIEIESLGNPSESISG
KTRGMKLRSGRLASHSKNKSIEKDQIGIDSMEGMFEKMKIGKEDQDEEKVKIKVEEKIAP
KEEKIEIKVEDKITPKKEKISPKKETITPKKEKITPKKEEENKTQTQRLKLVWKSEGIN
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaataactaatccatcaccatcatcatcatcgtcagaagcagaagaagtggaa
ccaatcctatttatcattcaagatgactgttataaacatctttacaaacgaagccatcaa
cccatggaagtgtttgaaagacctcaaagattaagatatgtgaatttaggtttatcgagt
acattagcttggatctcaaatcaaaatcaacttcaaatctatccatcaatcaacaaccaa
catccatccttgacaaacctaatcatttcaaatcatttcatagtttctaaatcatcaaat
cgaattaatcttaatgatacttcattcaatcaaatccattcttcatcaaaaggacttgtc
tcttcatcgccatcaacaacaacgacctcaacctcttcatctcaatcattatcatctaaa
gttgatcaagaatctagttatctagatcaacttatcaagctatgtcgtcatacttctcat
caacatcaactaggtctatctgaagtacctgatcatcttcctcaaggggacttgtatctt
tcggcaggtaccgaattcgcagtgctaggagctattggagcctgttacgatgcactagat
tcagtcctcaaacccaatcaaacctcaacttcaaacctccaaaaaccatccactaaagct
ttcgtgaatattagaccaccaggacatcattgtacagatacagaacctatgggattttgt
tgggccaacaacgttttagtgagttgtatgtatgctcatctcaattatgcaatcgacagg
atatgtattgtagatatagatttacatcatgggaatggaagtcaacaaatcgtatgggaa
atcaatcaaagatcacaagaaagctcaaactcatccaactcaaaacgaaccttaaagatc
agttatagttcattacatgatatcaattcatatccatgtgaagatggacaattagataag
attagagaagcttcattgaacctttgtgttggtaattcgattcaacaattcattcaaaat
ttacatttagaagtttggaaggatgaaatcgatttctttgatagattgtatcctaagatt
tggaattcatttcaagatcatatgattatgttttttaaaatcacggatgctattgaggaa
aatagtttgatctttgttagtgctggatttgatgcatgtgaattagaaactgattcgatg
tcaagatatggaatgaaactacctacatcattttatcatcgattttccaaagatctaagt
caattttcacaaacctatactaaaggtcgagtgatttcattcttagaaggaggttatagt
gatcaaactttattaggtagtagtttaagttatttattaggtttgattgattatccaatc
gattttgaaaaagttccatgggaattagatcgaattgaaaagatattaaaattagtgatt
aaaaaaccaaatcaagaaattgaagatgaaatcgtattgattgaaaagattagagagatt
tttaattatttagatggatttgaaaaatcgaaaatcgaaatgagatctgaaatcaaaaag
atgggaaagaataaaatcgaaattgaatcattaggaaacccaagtgaaagtattagtggt
aaaacaagaggtatgaaattgagaagtggtagattagctagtcattcaaagaataaatca
atagaaaaagatcaaattggtattgattcaatggaaggaatgtttgagaaaatgaagatt
ggaaaagaagatcaagatgaagagaaagttaaaattaaagtagaagaaaagattgcacca
aaggaagagaaaattgaaattaaagtagaagacaagattacacctaaaaaagaaaagatc
tcacctaagaaagaaacaatcacacccaagaaagaaaagataacacccaagaaagaagaa
gaaaacaaaactcaaactcaaagattaaaactagtttggaaatcagaggggattaattaa

DBGET integrated database retrieval system