KEGG   Melampsora larici-populina: MELLADRAFT_41634Help
Entry
MELLADRAFT_41634  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mlr  Melampsora larici-populina
Pathway
mlr04011  MAPK signaling pathway - yeast
mlr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mlr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MELLADRAFT_41634
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    MELLADRAFT_41634
Enzymes [BR:mlr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MELLADRAFT_41634
Protein kinases [BR:mlr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   MELLADRAFT_41634
Chromosome and associated proteins [BR:mlr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     MELLADRAFT_41634
Exosome [BR:mlr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MELLADRAFT_41634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kinase-like Kdo FTA2
Motif
Other DBs
NCBI-GeneID: 18927996
NCBI-ProteinID: XP_007404236
JGI: Mellp1_41634
UniProt: F4R6E1
LinkDB All DBs
Position
Unknown
AA seq 344 aa AA seqDB search
MDRNFNVGTDYTVLDVVGEGAYGVVCSAVHEPSKQKVAIKKITPFDHSMFCLRTLREIKL
LRWFSHENIISILDIVKPPSIEEFSEVYLIQELMETDMHRVIRTQDLSDDHSQYFIYQTL
RGLKALHSAAVLHRDLKPSNLLLNSNCDLKICDFGLARSAFMGEQEATGFMTEYVATRWY
RAPEIMLTFKEYTKAIDVWSVGCILAEMLNGKPLFPGRDYHHQLTLILDVLGTPSLDDFY
AISSHRSRDYIRALPFKKKKPFSQLYPNASNLAVDLLEKCLTFNPKKRITCEEALKHPYL
AAYHDPDDEPDSPPLDPSFFHFDNGKEQLTREQLKQLIFNEVMN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaatttcaatgtgggaaccgattacactgttttggatgtagtaggcgaaggt
gcttacggtgtagtatgctctgcggttcatgaaccttcgaaacaaaaggttgcgatcaag
aagatcacacccttcgatcactcaatgttttgtttgagaacgttgagagagattaaactc
ttaagatggttctcacatgaaaatattataagtattttagatatcgtgaaacctccatcg
attgaagagttttcagaagtttatttgattcaagaattaatggaaactgatatgcatcga
gtgattcgaacccaagatctttctgatgatcattctcagtactttatttatcaaacctta
cgaggtctcaaggcactccattcagctgccgtactacaccgggacttgaagccttcgaat
ttactccttaactcaaactgtgatctcaagatctgtgattttggattggctagatcagct
ttcatgggtgaacaggaggctaccggtttcatgacagaatatgtagctactcgttggtat
cgagctccagagatcatgttaaccttcaaggaatacaccaaagctattgatgtttggagt
gtgggctgtatcttggcggaaatgttgaatggcaaaccacttttcccaggacgtgattat
catcatcaacttacgttgatcttggatgtcttaggaacaccctcactagatgatttctat
gcgatcagctcgcatcgatcgagagattatatccgagctttaccatttaagaaaaagaaa
ccattctctcaactttatccgaatgcatcgaatctagccgtcgatcttttagagaaatgt
ttaacatttaatcccaagaaacgaatcacatgtgaagaagcattaaaacatccttatcta
gcggcttatcatgatccagatgatgaacctgattcgcctccactcgatccttctttcttt
cattttgataatggtaaagaacaattaactagagaacaattaaaacaattgatctttaat
gaagtgatgaattaa

DBGET integrated database retrieval system