KEGG   Melampsora larici-populina: MELLADRAFT_50226Help
Entry
MELLADRAFT_50226  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
mlr  Melampsora larici-populina
Brite
Translation factors [BR:mlr03012]
 Eukaryotic Type
  Elongation factors
   MELLADRAFT_50226
 Prokaryotic Type
   MELLADRAFT_50226
Mitochondrial biogenesis [BR:mlr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MELLADRAFT_50226
Exosome [BR:mlr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MELLADRAFT_50226
  Exosomal proteins of breast cancer cells
   MELLADRAFT_50226
  Exosomal proteins of colorectal cancer cells
   MELLADRAFT_50226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 18928684
NCBI-ProteinID: XP_007415648
JGI: Mellp1_50226
UniProt: F4S2S1
LinkDB All DBs
Position
Unknown
AA seq 471 aa AA seqDB search
MNTNLFLNSKLINRNLTKPISRTRTFTSLTKPQAYHSQCFVSRQSIQIPSNHSKFNILSS
HSTGIRNYAAEASKKFTRSKPHMNIGTIGHVDHGKTTLTAAITKSLAAANSNNKFLDYSQ
IDKAPEEKARGITISTAHVEYETENRHYAHVDCPGHADYIKNMITGAAQMDGAILLVSAT
DGQMPQTREHLLLARQMGIQKLVVYVNKVDQIDDPEMLELVEMEMRDLLSSYGFDGEVTP
IIKGSALCALEDKNPEIGINSIKELMKATDDWLDQPIRDLDKPFLMPVEDVFSIPGRGTV
VTGRVERGTVMKGTELELLGLGMNQKVTLTGIEMFKKELERGEAGDNMGALLRGLKREQI
KRGMVLAYPGSIKPVKKFLASIYVLTKDEGGRYTPFMNNYRPQLFLRTSDVTVSLTFPEE
VSNRHEKQVFPGENVEMIGELVHEVAIELGSRFTIREGGKTVGTGLVSRIF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaacttattcttaaattcaaaacttatcaatcgaaaccttaccaaacccatc
tcaaggactagaacgttcacttcattaaccaaacctcaagcttatcattctcaatgtttt
gtatcaagacaatcgattcaaatcccatcaaatcattcaaaatttaacattttatcatct
cattcaacgggaattcgaaattatgcagctgaagcctctaaaaagtttaccaggtctaaa
cctcatatgaacattggtacgattggacatgtagatcatggaaaaacgacattaactgct
gctattacaaaatcacttgcagctgcaaattcaaataacaagtttttagattattctcaa
attgataaagcaccagaagaaaaagctagagggattacgatctcaactgcacatgtagaa
tatgaaactgagaatcgtcattatgcacacgtcgattgtcctggacacgcagattacatc
aaaaacatgatcacaggtgcagcacaaatggatggagcgatcttattagtctcagccaca
gatggacagatgccacagacaagagaacatttattattagcacgacagatgggaattcaa
aaattagtagtttatgtgaataaagtagatcaaatcgatgatccagagatgttagaatta
gttgagatggaaatgagagatttattaagtagttatggatttgatggagaagtcacaccg
atcatcaaaggttcagctctctgtgcacttgaagataagaatccggaaatcggaatcaat
agtattaaagaattaatgaaagctacagatgattggttagatcaacctattcgagattta
gataaaccattcttaatgccagttgaagatgtcttttcgattcctgggcgtggaactgta
gtaactggtcgagttgaaagaggaactgtgatgaaaggaaccgaattagaattattaggt
ttaggtatgaatcaaaaagtgactttaaccgggattgaaatgtttaaaaaagaattagaa
agaggtgaagctggtgataatatgggagcccttttaagaggattaaaacgagaacaaatc
aaacgaggcatggttttagcttatccaggttcgatcaaacccgtcaagaaattcttggca
agtatttacgtcttaactaaagatgaaggtggtcgatacacaccttttatgaataactat
cgacctcaattgtttttgagaactagtgatgtgaccgtcagtttaacctttccagaagaa
gttagtaatcgacatgaaaaacaagtcttcccaggtgagaatgtagaaatgattggtgaa
ttggttcatgaagtggccattgaacttggtagtcgatttacaattagagaaggtggtaaa
actgttggaactggtttggtttctagaatcttttaa

DBGET integrated database retrieval system