KEGG   Muricauda lutaonensis: VC82_115Help
Entry
VC82_115          CDS       T03884                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mlt  Muricauda lutaonensis
Brite
Enzymes [BR:mlt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VC82_115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu AHSA1 CHRD
Motif
Other DBs
NCBI-ProteinID: AKA33807
UniProt: A0A0D5YNL3
LinkDB All DBs
Position
132054..132641
Genome map
AA seq 195 aa AA seqDB search
MKRLLVLPLGLLLITAFSCKQAKKEADEATEEVEKTVEKVVEEVTVESLKFAMEPKSDSD
VKGEVTFTEEDGMVTMVATFSGLTPGEHAIHIHEKADCSSPDGTSTGGHWNPTFQPHGKW
GAEEGYHKGDIGNFEADADGNGSIEFSTDQWCIGCDDETKNIVGKAVIVHQGVDDFTSQP
SGAAGARISCTGIIQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattactagtattgcccttaggcctactactgataaccgcttttagctgcaaa
caggcaaaaaaggaggccgatgaggccaccgaagaagttgaaaagaccgttgaaaaggtg
gtcgaagaagtaacggtagaatcgttgaaatttgccatggagcccaaaagcgacagcgat
gtcaaaggtgaagtaacctttaccgaagaagatggtatggtcaccatggtggcgactttc
tcaggactaacccccggggaacacgccatacatatccatgagaaggccgactgttcttcc
ccagatggaacatcgaccggtggccattggaatcccacttttcaaccccacggaaaatgg
ggtgccgaagagggctaccacaaaggcgacataggtaattttgaggcagatgccgacggc
aatggcagcatcgaattttcaactgaccaatggtgcatcggctgcgacgacgagaccaag
aacattgtcggtaaggccgtaatcgtgcaccaaggtgtcgatgactttacatctcagcca
agtggcgcggcaggggcccgtatctcatgcaccggaatcattcaataa

DBGET integrated database retrieval system