KEGG   Muricauda lutaonensis: VC82_1876Help
Entry
VC82_1876         CDS       T03884                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mlt  Muricauda lutaonensis
Pathway
mlt00020  Citrate cycle (TCA cycle)
mlt00310  Lysine degradation
mlt00380  Tryptophan metabolism
mlt01100  Metabolic pathways
mlt01110  Biosynthesis of secondary metabolites
mlt01120  Microbial metabolism in diverse environments
mlt01130  Biosynthesis of antibiotics
mlt01200  Carbon metabolism
Module
mlt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mlt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VC82_1876
  Amino acid metabolism
   00310 Lysine degradation
    VC82_1876
   00380 Tryptophan metabolism
    VC82_1876
Enzymes [BR:mlt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     VC82_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AKA35481
UniProt: A0A0D5YUC0
LinkDB All DBs
Position
1980368..1983178
Genome map
AA seq 936 aa AA seqDB search
MDKYSFLNAAHTSFFAELYDRYLTNPDSIEPSWRAFFQGFDFGLESSLDELDIDTSKDGG
LTKVNGQMVEVPLSLQKEFQVIRLIDGYRSRGHLFTKTNPVRERRKYSPTLDIENFGLNE
NDLETVFDAGSIIGLGPSKLKDIISHLERIYCDAIGVEYMYIRSPERIQWIQDWLNVNDN
HPNFTAEEKKNILRKLNEAVSFESFLHTKYVGQKRFSLEGGESLIPALDVIMEKAAEAGV
KQFVMGMAHRGRLNVLTNIFGKSPKDIFSEFDGKDYEETIFDGDVKYHLGWTSRRETDSG
RVINMNIAPNPSHLETVSAVVEGIARAKQDRSHQENASEVLPILVHGDAAIAGQGVVYEV
VQMAQLDGYRTEGTIHIVVNNQIGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADDAEAV
VHASIFALEYRMRYKCDVFLDLLGYRKYGHNEGDEPKFTQPVLYKAISKHKNPRDIYAEK
LISEGIIDEGYPKQLEEEYKSRLEEDLLDSRKVEKTRITPFMQDEWEGFKQVTEEAMLNL
VETSYDLKKLDEVAESITKLPEDKKFLRKLVRLVESRHKMYFEDNKLDWAMGELLAYASL
LEEGYDVRMTGQDVERGTFSHRHAVIKTEMHEEEVVLLNEMGKNQNGTFHIYNSLLSEYG
VMGFDYGYAMASPKTLTIWEAQFGDFSNGAQIVIDQYISAAEDKWKLQNGLVLFLPHGYE
GQGAEHSSARMERYLQLCAKDNMFVADVTTPANMFHLLRRQMKANFRKPLVVFTPKSLLR
HPKVVSTKEEMAHGSFQMLIDDETADVSKIKMLVFCTGKFYYDLLAKREELDRDDVALVR
LEQLFPLPAEQMRAIMKKYKNADDVVWAQEEPRNMGAWGFLLMHLEEAKSFRVCSRRFYG
APAAGSAIRSQRRHAQVIEYVFDKTKDNTVRRTNKA
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggataagtattcctttctaaacgcggcgcacacctctttttttgctgagctttacgac
agatatctcaccaatcctgatagtattgaacccagttggcgagcattctttcaaggattc
gattttggtttggagagttcgttggacgagctcgatatcgacacctcaaaagacggcggc
ctgaccaaggtcaatggccaaatggttgaggtgcccctatcgttgcaaaaagaatttcag
gtcattcgcctgatcgacggatatcgctcccgcggccatctgttcaccaaaacaaatccg
gttcgtgaaaggcgcaaatattcgcccaccctcgatattgagaactttgggctaaacgaa
aacgatcttgaaacggtttttgatgccggcagtataattggtctcgggccaagcaaactg
aaagacattatcagccacctagagcgcatttattgcgatgccattggggtggaatatatg
tacatacgatcgcccgaacgcatccagtggatacaagattggctgaacgtcaatgacaac
catccgaattttacggcagaggaaaagaaaaacatcctcagaaaattgaacgaggcagtg
tcgttcgaaagttttctgcacaccaaatacgtcgggcaaaaacgcttctcgttagagggt
ggcgaatcacttatacctgccctggacgttattatggaaaaggcggccgaagcaggggta
aaacaatttgtgatgggcatggcccaccgcggccggctaaatgtactcaccaatatcttt
ggcaaatcaccaaaggatattttcagtgaatttgatggtaaagattatgaggagaccata
tttgatggtgatgtaaagtaccacttgggctggacctctaggcgtgaaaccgattcaggt
agggtaatcaatatgaacattgcaccgaacccttcgcacctagaaaccgtcagtgccgtt
gtagaaggtattgcccgggccaaacaagaccgttcgcaccaagaaaacgcctcagaggta
ttgcccattttggtccatggcgatgcggccatagcagggcagggcgtcgtgtacgaagtg
gttcaaatggcccagctcgatgggtaccgtactgagggtaccatacatattgtggtaaac
aaccaaattggttttaccaccaactatctcgatgcacgctcatcgacctattgtaccgac
gttgcaaaggtaaccttgtcgcccgtgctgcacgtcaatgccgatgatgcggaggcggtg
gtacatgcatcgatctttgccctcgaataccgaatgcgctataagtgcgacgtgttcttg
gatttattgggataccgaaaatatggacacaacgagggcgatgagcccaagtttacacag
ccggtattgtacaaggcgatttcaaaacacaagaacccacgtgatatttatgccgagaaa
ttgatttctgagggcattatcgatgaggggtatccgaagcagcttgaagaagaatacaaa
agtcggttggaagaagatctactcgattcaagaaaggttgaaaagacaagaattaccccc
ttcatgcaagatgaatgggaaggtttcaagcaggtaaccgaagaggccatgctaaacctg
gtcgaaacttcctatgatttgaaaaagttggatgaggtggccgaaagcatcaccaaactc
cccgaagacaaaaaattcttgcgcaaactggtccgactggtcgaaagtaggcacaaaatg
tattttgaagacaataagctcgattgggccatgggcgagttgttggcctatgcatcattg
cttgaagagggttacgatgtgcgcatgaccgggcaagatgttgaaaggggaactttttcg
caccgtcatgcggtgatcaaaacagagatgcacgaagaagaggtcgtcttgttgaacgaa
atgggcaagaaccagaacggcacttttcatatctacaactcactcctttcagagtatggt
gtcatgggctttgattatggttatgccatggccagcccgaagaccctgaccatttgggag
gcacagttcggcgacttcagcaacggtgcccagattgtgatcgaccagtacatttcggct
gcggaagacaagtggaaactgcagaacgggttggtgctctttttgccgcatggttacgaa
gggcagggagccgagcactcctcggcccgtatggagcgctatttacaactttgcgccaaa
gacaatatgtttgtcgccgatgtaactaccccggccaatatgttccatttgttgcgaaga
cagatgaaggccaactttcgaaagcccttggtggtctttacgcccaaaagtctcttaagg
catccgaaggtcgtctcgaccaaagaagagatggcccatggcagctttcaaatgttgatc
gatgatgaaacggccgatgtgtccaaaatcaagatgctggtcttctgtacaggaaaattc
tattacgacctgttggcaaagcgggaagagctggaccgagatgatgtggccttggtgaga
cttgagcaattgtttccattgcctgccgagcaaatgcgggccataatgaagaaatataaa
aatgccgatgatgtggtgtgggcccaagaagagccccgaaacatgggggcttggggcttt
ttgctgatgcaccttgaagaggcaaaaagtttccgggtctgctctagaaggttttatggg
gcgccggcagcaggcagtgctatacgatcccagcgtaggcatgcacaggtaattgaatat
gtttttgacaagacaaaagacaatacggttcgaagaacaaacaaagcataa

DBGET integrated database retrieval system