KEGG   Micrococcus luteus: Mlut_16720Help
Entry
Mlut_16720        CDS       T00918                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
mlu  Micrococcus luteus
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mlut_16720
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Mlut_16720
Enzymes [BR:mlu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Mlut_16720
Peptidoglycan biosynthesis and degradation proteins [BR:mlu01011]
 Precursor biosynthesis
  Racemase
   Mlut_16720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1824585..1825790)
Genome map
AA seq 401 aa AA seqDB search
MSRADVNPADTERAVRIDLAAVRHNVGVLRERIRRPDGSRPLLTAVVKADAYGHGAVAVA
RAAAAAGADRLGVAHVREALALRAAGVPLPVLAWLHTGATDFAAAVEAEVTLGVSGWDLD
AAADAVRGLRARGGAGPEARAVLHLKADTGLGRHGCTPERWPAFVARAAELEAAGLVRVE
GVFSHLGVADEPDRAAETTAQLLRFERMAAEAAETLGHPLLRHLANTPATLARPDTHLDM
VRVGLGLYGLSPFAEVTAAELGLRPAMSLVTVLANVKAVPAGQGVSYGFRHVTAEPTTLG
LVPVGYADGVPRVVEGTRVHVGGRTVPVVGRIAMDQFVVDLGPDAADAPGDAVELFGPAS
GIPVEEWAAAAGTINYELVTRIGGRVDRQHVDPTPTQEARP
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgccgacgtcaacccggcggacaccgagcgcgccgtacgcatcgacctggcg
gccgtccggcacaacgtgggcgtgctgcgggagcggatccggcgccccgacggcagccgg
ccgctgctgaccgccgtcgtcaaggctgacgcctacggccacggcgcggtggccgtcgcc
cgcgccgccgcggccgccggcgcggaccggctcggggtggcccatgtgcgcgaggccctg
gccctgcgcgcggcgggggtgcccctgcccgtgctcgcgtggctgcacaccggggccacg
gacttcgccgccgcggtggaggcggaggtgaccctcggcgtctcgggctgggacctcgac
gccgccgccgacgccgtccgcgggctgcgggcccgcggcggggccggacccgaggcccgc
gccgtcctgcacctgaaggcggacaccggcctgggccgccacggctgcacgcccgagcgg
tggcccgcgttcgtcgcgcgtgccgccgagctcgaggccgcgggcctcgtgcgggtggag
ggcgtgttctcccacctcggcgtggcggacgagccggaccgggccgccgagaccacggcg
cagctgctgcggttcgaacggatggccgccgaggccgccgagacgctcggccacccgctg
ctgcggcacctggccaacacgcccgccaccctcgcccggccggacacgcacctggacatg
gtgcgcgtcggcctgggcctgtacgggctctccccgttcgcggaggtcaccgccgccgag
ctcgggctgcgcccggccatgtccctcgtcaccgtcctggccaacgtcaaggccgtcccc
gccgggcagggcgtgtcctacgggttccgccacgtcacggcggagcccaccaccctcggg
ctcgtgcccgtcggctacgccgacggcgtcccgcgcgtcgtcgagggcacgcgcgtccac
gtcggcggccggaccgtccccgtggtgggccgcatcgcgatggaccagttcgtggtggac
ctcggcccggacgccgcggacgcgcccggcgacgccgtcgagctgttcggaccggcctcc
ggcattccggtggaggagtgggccgcggccgccgggacgatcaactacgagctggtgacc
cgcatcggaggccgcgtggaccggcagcacgtggaccccacgccgacccaggaggcccgc
ccatga

DBGET integrated database retrieval system