KEGG   Micrococcus luteus: Mlut_17370Help
Entry
Mlut_17370        CDS       T00918                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mlu  Micrococcus luteus
Pathway
mlu00010  Glycolysis / Gluconeogenesis
mlu00030  Pentose phosphate pathway
mlu00051  Fructose and mannose metabolism
mlu00052  Galactose metabolism
mlu00680  Methane metabolism
mlu01100  Metabolic pathways
mlu01110  Biosynthesis of secondary metabolites
mlu01120  Microbial metabolism in diverse environments
mlu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlut_17370
   00030 Pentose phosphate pathway
    Mlut_17370
   00051 Fructose and mannose metabolism
    Mlut_17370
   00052 Galactose metabolism
    Mlut_17370
  Energy metabolism
   00680 Methane metabolism
    Mlut_17370
Enzymes [BR:mlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mlut_17370
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Mlut_17370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACS31223
UniProt: C5CC82
LinkDB All DBs
Position
1880806..1881825
Genome map
AA seq 339 aa AA seqDB search
MLTSGGDCPGLNAVIRSAVLHGIKSYDMEMVGIRNGWSGLIEKDVEDLPRSRVRGLARTG
GTILGTSRTHPYDAEGGGPENMLRNLRELDIDAVIAIGGEGTLAGANRLAADGLPIVGVP
KTIDNDLQGTDYTFGFDTAVQIATDAMDRLRTTGESHHRCMVAEVMGRHVGWIALHSGMA
AGAHAILIPEVRTPMSQVAEWVQQVHDRGRSPLVVVAEGFIPEGHDDPLAEAGVEASGRP
RLGGIGEWVTREIEEMTGIETRSTILGHIQRGGAPTATDRVLSTRFGMGAVDLVAQRRWG
QMVAANGTEIISIPMSAALKGLKKVPVSRYDEAKILFGR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctcacctccggaggcgactgccccggcctcaacgccgtcatccgctccgccgtcctg
cacggcattaagtcgtacgacatggagatggtgggcatccgcaacgggtggtccggcctg
atcgagaaggacgtcgaggacctgccccgctcccgcgtgcgcggcctggcccgcaccggc
ggcaccatcctcggcacctcgcgcacgcacccctacgacgccgagggcggcggcccggag
aacatgctccgcaacctgcgcgagctggacatcgacgccgtcatcgccatcggcggcgag
ggcaccctggccggcgcgaaccgcctggccgcggacgggctgccgatcgtgggcgtgccc
aagacgatcgacaacgacctgcagggcaccgactacacgttcggcttcgacacggccgtg
cagatcgccacggacgccatggaccgactgcgcaccacgggcgagtcccaccaccgctgt
atggtcgccgaggtcatgggccgccacgtcggctggatcgccctgcactcgggcatggcc
gccggcgcccacgcgatcctcatccccgaggtccgcaccccgatgtcccaggtcgccgag
tgggtgcagcaggtccacgaccgcggccgctccccgctggtcgtggtggcggagggcttc
atccccgagggccacgacgacccgctggccgaggccggggtcgaggcgtccggccggccg
cgtctgggcggcatcggcgagtgggtgacccgcgagatcgaggagatgacgggcatcgag
acgcgcagcaccatcctgggccacatccagcgcggcggcgcccccaccgccacggaccgc
gtgctctccacgcgcttcggcatgggcgccgtcgatctcgtcgcgcagcgccgctgggga
cagatggtggcggccaacggcacggagatcatctccatccccatgagcgccgccctcaag
ggcctcaagaaggtgccggtctcgcgctacgacgaggcgaagatcctgttcggccggtga

DBGET integrated database retrieval system