KEGG   Mycobacterium marinum E11: MMARE11_10760Help
Entry
MMARE11_10760     CDS       T04774                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase, GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00250  Alanine, aspartate and glutamate metabolism
mmae00410  beta-Alanine metabolism
mmae00430  Taurine and hypotaurine metabolism
mmae00650  Butanoate metabolism
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
mmae01120  Microbial metabolism in diverse environments
mmae02024  Quorum sensing
Module
mmae_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmae00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MMARE11_10760 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MMARE11_10760 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MMARE11_10760 (gadB)
   00430 Taurine and hypotaurine metabolism
    MMARE11_10760 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MMARE11_10760 (gadB)
Enzymes [BR:mmae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MMARE11_10760 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CDM75224
LinkDB All DBs
Position
1289417..1290802
Genome map
AA seq 461 aa AA seqDB search
MSRSHPSVPAHSIAPAYTGRLFTAPVPALRLPEESMDPEAAYRFIHDELMLDGSSRLNLA
TFVTTWMDPEAGKLMAETFDKNMIDKDEYPATAAIETRCVSMVADLFHAEGLRDDDPSSA
TGVSTIGSSEAVMLGGLAMKWRWRQKIGKDWKGRTPNLVMGSNVQVVWEKFCRYFDVEPR
YLPMEKGRYVITPEQVVDAVDEDTIGVVAILGTTYTGELEPVDEICAALDRLAAGGGVDV
PVHVDAASGGFVVPFLHPDLKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSSEHLPED
LVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYIKVMQALSETARWLSAQLR
EVDHCELIADGSAIPVVAFRLAGDRGYTEFDLSHELRTFGWQVPAYTMPDNATDVSVLRI
VVREGLSADMARALHDDAVTSLRTLDKVKPGGNYDGQHFAH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgtagccacccgtcggtacccgcacattcgatcgctccggcctacaccggccgg
ctgttcaccgctccggtaccggcgttgcggctgcccgaggagtcgatggatcccgaagcc
gcctaccggttcatccacgacgagctgatgctcgacggtagctcgcggctgaacctggcc
accttcgtcaccacctggatggatcccgaggccggcaagctgatggccgagacgttcgac
aagaacatgatcgacaaagacgaatacccggcgaccgcggcgatcgagacccgctgcgtg
tcgatggtcgccgacctctttcacgccgagggactgcgcgacgacgacccgtccagcgcc
accggggtgtccaccatcggctccagcgaggcggtgatgctcggcggcctggccatgaag
tggcggtggcggcagaagatcggcaaggactggaaaggccgcacaccgaatctggtgatg
ggctccaacgtccaggtggtgtgggagaagttctgtcgctacttcgacgtcgagccgcgc
tacctgccgatggagaaggggcgctacgtcatcacccccgaacaggtcgtcgacgccgtc
gacgaggacaccatcggtgtggtcgcgatcctgggcaccacctacaccggcgagctggaa
ccggttgacgagatctgcgcggcgctggacagattggcggccggcggcggcgttgatgtg
cccgtgcacgtggacgccgccagcgggggcttcgtggtgccgttcctgcatccagacctc
aagtgggacttccggctgccgcgggtggtctcgatcaatgtcagcggtcacaaatacggg
ctgacctatcccggcgtcggattcgtcgtgtggcgcagctccgaacacctgccggaggat
ctggttttccgggtcaactacctgggcggggatatgcccacattcacactcaacttctcc
cggcccggcaaccaagtcgtcggccagtactacaacttcctgcggctgggccgggagggc
tacatcaaggtcatgcaggccctgtcggagaccgcgcgctggctctccgcgcagctgcgt
gaggtagatcactgcgagctgatagcggacggttcggcgatcccggtggtcgccttccgg
ctggccggcgaccgcggctacaccgagttcgacctctcccacgagctgcgaaccttcggg
tggcaggtgcccgcctacaccatgccggacaacgccaccgacgtatcggtgctgcgcatc
gtggtgcgcgaaggtctgtccgccgacatggcgcgcgccctgcacgatgatgccgtcacc
tcactgcgcacgctggacaaggtcaagccgggcggcaactacgacggacagcacttcgcg
cactaa

DBGET integrated database retrieval system