KEGG   Mycobacterium marinum E11: MMARE11_11300Help
Entry
MMARE11_11300     CDS       T04774                                 

Gene name
fadD29_1
Definition
(GenBank) fatty-acid-CoA ligase FadD29_1
Organism
mmae  Mycobacterium marinum E11
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1350598..1352589
Genome map
AA seq 663 aa AA seqDB search
MSRPTAKDRTAAEAVMCAIQANPATDAVRFLPRGEGPGTVISYEGLHARAAHLAAVLQAR
GAQGERVILASRDNIEMTVGLVACLYSGAVAVPVPVPNMNKLGPALLRLQAIARDAQARV
FLTDLPSVDSQSNVRTLPDGLSGLTWLNTDDASADRADWQPPRYAPESAALLQYTSGSTG
QPKGVMLTQANLLSNAHQIERRWEQDQNELLVSWLPQYHDFGLIFMALQALYLGATVVSM
PPSAFVQDPLRWLRCLTQYRGTNSGAPNFAFDLCVEQSTPAQREGLDLRSVKALNCGAEP
VRAETMRRFLAAFAPFGLRPDALRPGYGLAEATLFVTGWRGPTVKTLTLDQRQLNEGRVV
ECDISATPLAEVVCCGPAGPEVELAIVSTQTQQPCAADEVGEIWVRGPNISRGYFNGAGA
SQDCFGNVAGHGQYLRTGDLGFVQDGDLYVTGRLKDLVIVRGVNHYPQDIEFSVEQSHPA
IRSGYCAAFTLEVDGEERLGVAAEIAADDPAQDTLESAMDSILQAITSHHEVVPYRLVLL
ARGAIPKTSSGKIQRQLCKQLLLTDQLPILGDRVSTATISSTPQQPDGGARSPKYRAMEQ
YLLELLNLSPEELESGNNLAAYGFDSIDGAALAKKIKADWDIEVPMEILPLLTIRDLVDT
LAN
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggccgacagccaaagatcggacggccgccgaggccgtcatgtgcgccatacag
gccaacccggccaccgacgcggtgcgctttttgccccgaggtgaggggcccggcacggtg
atcagctacgaagggctgcacgcgcgcgccgcccatctggcggcggtgctgcaggcgcgg
ggggcgcaaggcgagcgggtgatcctggccagtcgcgacaacatcgagatgacagtgggg
ctggtcgcctgcctgtacagcggcgcggtagcggtgccggtgccggttccgaatatgaac
aagttggggccggcattgctgcgactgcaggccattgcgcgagatgcgcaggcgcgcgtc
ttcttgactgacctgccgtcggtggactctcaatcaaacgtgcgcaccctgcccgacggg
ctttcggggctgacctggctgaacaccgacgacgccagcgccgaccgggccgactggcaa
cccccgcggtatgcgcccgagagcgcggcgctgctgcagtacacctctggctcgaccgga
cagcccaaaggggtgatgctcacccaggccaacttgctgtccaatgcccatcagatcgag
cggcgttgggaacaagaccaaaatgagttgcttgtctcctggctccctcagtatcacgac
tttgggttgatcttcatggcgctacaagcgctctatctgggggccacggtggtttcgatg
cccccgtccgcctttgtgcaggatccgctgcgttggcttcgctgcctcacccagtaccgc
ggtaccaacagcggcgcgcccaacttcgccttcgatctctgcgtggagcaaagcacgcca
gctcagcgcgaggggctggacctgcgtagcgtcaaggcattgaactgcggcgctgagccg
gtgcgggcggaaacgatgcgccgcttcctggccgcgtttgccccgttcgggctgcggccg
gacgcccttcggcccggttacggtctggccgaagccacgttgttcgtgaccggctggcgc
gggcccacagtcaagacattgacgctggaccagcgccagctcaacgagggccgggtcgtg
gaatgtgacatttccgcaacgcctttggcggaggttgtctgctgcggtccggcaggtcca
gaagtagagctggccattgtctcgacgcagacacaacagccatgcgctgccgacgaagtg
ggcgagatctgggtgcgtggacccaatatcagccggggctacttcaacggtgccggcgca
agccaagactgcttcggcaacgtcgcgggccatggacagtacttgcgtacgggcgacctg
ggttttgtgcaagatggcgacctgtacgtgacgggtcggctgaaggacctggtgatcgtg
cgcggagtcaaccactacccgcaagacatcgaattctcggtcgagcaatcccaccccgcc
atccggtccggatactgcgccgccttcacgctggaggtcgatggtgaagagcgactgggc
gtcgccgcggaaatcgcggcagacgatccagcgcaagacaccctggaaagtgcgatggac
tcgattcttcaggccatcaccagccaccacgaggtggtgccctaccggctggttctcttg
gcccgcggcgccattcccaagacctccagtggcaagatccagcggcaactgtgcaaacag
ctgctgttgaccgatcagctgccgattctcggcgaccgtgtcagtaccgcgacgatatcg
tcgacgccgcagcaacctgatggtggcgcgcgatcgccaaagtatcgcgcgatggagcag
tacctcctcgagctgttgaatctgagccccgaagaactggagagcggcaacaatctagcc
gcctatggttttgattccatcgatggcgcagctttggctaagaaaatcaaggccgactgg
gacattgaagtcccgatggaaatattgccgctcctgaccatcagagatctcgtggatacg
ctcgccaactaa

DBGET integrated database retrieval system