KEGG   Mycobacterium marinum E11: MMARE11_50830Help
Entry
MMARE11_50830     CDS       T04774                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
mmae  Mycobacterium marinum E11
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
6062003..6063079
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPISPMLAKAVKTIPADASYEPKWDGFRSICFRDNDEVELGSRNERPLTRYFPE
LVAAVRAELPRRCVLDGEIVIATGHGLDFEALQQRIHPADSRVRMLAEHTPASFIAFDLL
ALGDDDYTTRPFVERRAALVEAVGSGPSIHVTPATTDQATARRWFEEFEGAGLDGVIAKP
LAVTYQPDKRVMFKIKHERTADCVLAGYRLHKSGGDVIGSLLLGLYQDDGQLASVGVIGA
FPMAERRRLFTELQELVTSFDDHPWNWAAHQSGERTPRKNEFSRWNAGKDLSFVPLRPER
VVEVRYDHMEGPRFRHTAQFNRWRPDRDPRSCTYAQLEQPLTFSLDDIVAGLGPRCGR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggacctaccagtcatgccgccgatttcgccgatgctggccaaggcggtcaagacgatc
ccggccgatgcgtcctatgaacccaaatgggatggattccgctccatctgttttcgcgac
aacgatgaggtagagctcggcagccgcaacgaacgtccgctgacccgctacttcccggaa
ctggtcgcggcggtccgggcggagctgccgcggcgctgcgtccttgacggcgagatcgtg
atcgccaccggccacggcctggatttcgaggcgctgcaacagcgcatccaccccgccgat
tcccgggtgcggatgctcgccgaacacaccccggcatccttcatcgccttcgacctgctg
gccctcggcgacgacgactacacgacgcgtccatttgtcgagcggcgcgcggcgctggtc
gaggcggtcggctccggcccatcgatccatgtcaccccggccaccaccgatcaggcgacg
gcacggcggtggttcgaagagttcgagggcgccggcctcgacggagtgatcgccaaaccg
ctggcggtcacctatcagccggacaagcgcgtgatgttcaagatcaagcacgagcgcacc
gccgactgcgtgctggccggatatcgcctccacaaatccggcggtgacgtcatcggttcg
ctattgctgggcctctaccaagacgacgggcaattggcgtcggtcggcgtgatcggggca
ttcccgatggccgaacgccggcggctcttcaccgagctgcaggagctggtgaccagcttc
gacgaccatccgtggaactgggccgcccaccagtccggcgaacgcacgccacgcaaaaac
gagttctcccgctggaacgccggcaaagacctctcgtttgtgccgctgcgccccgaacgc
gtggtcgaggtgcgctacgaccacatggagggcccgcggttccgtcacaccgcccagttc
aaccggtggcgtcccgaccgcgatccgcgttcctgcacctacgcccagctcgagcaaccg
ctgacgttcagtctcgacgacatcgttgctggtctcggaccccgctgcgggcgctag

DBGET integrated database retrieval system